SPAG4 Antibody

Images

 
Immunohistochemistry-Paraffin: SPAG4 Antibody [NBP2-13367] - Staining of human testis shows distinct cytoplasmic positivity in spermatids(acrosomal cap).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPAG4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSER VAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYAD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPAG4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPAG4 Protein (NBP2-13367PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPAG4 Antibody

  • acrosomal protein ACR55
  • CT127
  • Outer dense fiber-associated protein SPAG4
  • Sad1 and UNC84 domain containing 4
  • sperm associated antigen 4
  • sperm tail protein
  • sperm-associated antigen 4 protein
  • SUN domain-containing protein 4
  • SUN4cancer/testis antigen 127

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38050
Species: Hu
Applications: IHC, IHC-P
H00004957-M01
Species: Hu, Ce
Applications: WB, ELISA, ICC/IF, IHC
NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74638
Species: Hu
Applications: WB (-), ICC/IF, IP
NBP2-13399
Species: Hu
Applications: IHC, IHC-P
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-46005
Species: Hu
Applications: WB, IHC, IF
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13367
Species: Hu
Applications: IHC, IHC-P

Publications for SPAG4 Antibody (NBP2-13367) (0)

There are no publications for SPAG4 Antibody (NBP2-13367).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPAG4 Antibody (NBP2-13367) (0)

There are no reviews for SPAG4 Antibody (NBP2-13367). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPAG4 Antibody (NBP2-13367) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPAG4 Products

SPAG4 NBP2-13367

Bioinformatics Tool for SPAG4 Antibody (NBP2-13367)

Discover related pathways, diseases and genes to SPAG4 Antibody (NBP2-13367). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPAG4 Antibody (NBP2-13367)

Discover more about diseases related to SPAG4 Antibody (NBP2-13367).
 

Pathways for SPAG4 Antibody (NBP2-13367)

View related products by pathway.

PTMs for SPAG4 Antibody (NBP2-13367)

Learn more about PTMs related to SPAG4 Antibody (NBP2-13367).

Blogs on SPAG4

There are no specific blogs for SPAG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPAG4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPAG4