SOX4 Antibody (1E5) - Azide and BSA Free

Sandwich ELISA: SOX4 Antibody (1E5) [H00006659-M02] - Detection limit for recombinant GST tagged SOX4 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA
• Clone: 1E5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SOX4 Antibody (1E5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SOX4 (NP_003098, 45 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SOX4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX4 Antibody (1E5) - Azide and BSA Free

• ecotropic viral integration site 16
• EVI16
• SRY (sex determining region Y)-box 4
• SRY-related HMG-box gene 4
• transcription factor SOX-4

Background

This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SOX4
• Uniprot:
  • NP_003098(Human)