SOX4 Antibody (1E5.)

Images

 
Sandwich ELISA: SOX4 Antibody (1E5) [H00006659-M02] - Detection limit for recombinant GST tagged SOX4 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1E5.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SOX4 Antibody (1E5.) Summary

Immunogen
SOX4 (NP_003098, 45 a.a. - 136 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SOX4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX4 Antibody (1E5.)

  • ecotropic viral integration site 16
  • EVI16
  • SRY (sex determining region Y)-box 4
  • SRY-related HMG-box gene 4
  • transcription factor SOX-4

Background

This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85823
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF3075
Species: Hu
Applications: WB, ICC
AF4070
Species: Hu
Applications: WB, ICC
AF5286
Species: Hu
Applications: WB
NBP2-55322
Species: Hu
Applications: ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
AF5596
Species: Hu
Applications: WB, IHC, ICC
H00006659-M02
Species: Hu
Applications: ELISA

Publications for SOX4 Antibody (H00006659-M02) (0)

There are no publications for SOX4 Antibody (H00006659-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX4 Antibody (H00006659-M02) (0)

There are no reviews for SOX4 Antibody (H00006659-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SOX4 Antibody (H00006659-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX4 Products

Bioinformatics Tool for SOX4 Antibody (H00006659-M02)

Discover related pathways, diseases and genes to SOX4 Antibody (H00006659-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX4 Antibody (H00006659-M02)

Discover more about diseases related to SOX4 Antibody (H00006659-M02).
 

Pathways for SOX4 Antibody (H00006659-M02)

View related products by pathway.

PTMs for SOX4 Antibody (H00006659-M02)

Learn more about PTMs related to SOX4 Antibody (H00006659-M02).
 

Research Areas for SOX4 Antibody (H00006659-M02)

Find related products by research area.

Blogs on SOX4

There are no specific blogs for SOX4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX4 Antibody (1E5.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX4
Uniprot