SOX11 Antibody (CL0142)

Images

 
Western Blot: SOX11 Antibody (CL0142) [NBP2-14782] - Analysis in control (vector only transfected HEK293T lysate) and sOX11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: SOX11 Antibody (CL0142) [NBP2-14782] - Staining of mouse embryo E14 shows nuclear immunoreactivity in the developing eye.
Immunohistochemistry-Paraffin: SOX11 Antibody (CL0142) [NBP2-14782] - Staining of human chronic lymphoid leukemia shows no positivity in tumor cells.
Immunohistochemistry-Paraffin: SOX11 Antibody (CL0142) [NBP2-14782] - Staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: SOX11 Antibody (CL0142) [NBP2-14782] - Staining of mouse embryo E14 shows nuclear immunoreactivity in the developing forebrain neurons.
Simple Western: SOX11 Antibody (CL0142) [NBP2-14782] - Simple Western lane view shows a specific band for SOX11 in 0.2 mg/ml of U-251MG sp (left) and SHSY5Y (right) lysate. This experiment was performed under reducing ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clone
CL0142
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SOX11 Antibody (CL0142) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG2a
Clonality
Monoclonal
Host
Mouse
Gene
SOX11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • Simple Western 5 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reactivity Notes

Rat (82%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for SOX11 Antibody (CL0142)

  • SOX11
  • SRY (sex determining region Y)-box 11
  • SRY (sex-determining region Y)-box 11
  • SRY-related HMG-box gene 11
  • transcription factor SOX-11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61420
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF3075
Species: Hu
Applications: WB, ICC
AF2569
Species: Hu
Applications: WB, ICC
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF4070
Species: Hu
Applications: WB, ICC
NBP2-55322
Species: Hu
Applications: ICC/IF
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2806
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2864
Species: Hu
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-55789
Species: Hu
Applications: WB, ICC/IF
AF5286
Species: Hu
Applications: WB
NBP1-49872
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP2-59059
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00030812-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF3369
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-14782
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P

Publications for SOX11 Antibody (NBP2-14782) (0)

There are no publications for SOX11 Antibody (NBP2-14782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOX11 Antibody (NBP2-14782) (0)

There are no reviews for SOX11 Antibody (NBP2-14782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX11 Antibody (NBP2-14782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOX11 Products

Bioinformatics Tool for SOX11 Antibody (NBP2-14782)

Discover related pathways, diseases and genes to SOX11 Antibody (NBP2-14782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX11 Antibody (NBP2-14782)

Discover more about diseases related to SOX11 Antibody (NBP2-14782).
 

Pathways for SOX11 Antibody (NBP2-14782)

View related products by pathway.

PTMs for SOX11 Antibody (NBP2-14782)

Learn more about PTMs related to SOX11 Antibody (NBP2-14782).

Blogs on SOX11.

SOX-11 seals your fate
The SOX-11 transcription factor is a member of the SOX family known to be involved in embryonic development regulation and cell fate determination. The protein acts as a transcriptional regulator and appears to modulate fundamental aspects of normal e...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX11 Antibody (CL0142) and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX11
Entrez