SOS2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit SOS2 Antibody - BSA Free (NBP2-55873) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PPVPLRPPEHFINCPFNLQPPPLGHLHRDSDWLRDISTCPNSPSTPPST |
| Predicted Species |
Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SOS2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for SOS2 Antibody - BSA Free
Background
SOS2 (son of sevenless homolog 2) is a human paralog of the Drosophila SOS gene. Drosophila SOS was originally identified as a gene that functioned downstream of the sevenless gene in the Ras/MAP kinase signaling pathway. SOS and its paralogs, SOS1 and SOS2, function as guanine nucleotide exchange factors that act on Ras-GTPases to cause release of GDP in exchange for GTP. Although targeted disruption of SOS1 results in embryonic lethality, disruption of SOS2 does not have any effects on mouse development, growth, or fertility.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF
Publications for SOS2 Antibody (NBP2-55873) (0)
There are no publications for SOS2 Antibody (NBP2-55873).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SOS2 Antibody (NBP2-55873) (0)
There are no reviews for SOS2 Antibody (NBP2-55873).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SOS2 Antibody (NBP2-55873) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SOS2 Products
Research Areas for SOS2 Antibody (NBP2-55873)
Find related products by research area.
|
Blogs on SOS2