SOCS-5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SOCS-5 Antibody [NBP1-85608] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SOCS-5 Antibody [NBP1-85608] - Staining of human endometrium shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOCS-5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLGPKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVHTQI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOCS5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SOCS-5 Protein (NBP1-85608PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOCS-5 Antibody

  • CIS6
  • CIS6Cytokine-inducible SH2 protein 6
  • CISH5
  • CISH6
  • CISH6CIS-6
  • KIAA0671Cytokine-inducible SH2-containing protein 5
  • SOCS5
  • SOCS-5
  • SOCS-5CISH5
  • suppressor of cytokine signaling 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
NB100-56637
Species: Hu, Mu
Applications: WB
MAB5628
Species: Hu, Mu
Applications: WB
MAB5808
Species: Hu
Applications: WB, ICC
MAB5809
Species: Hu
Applications: WB
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
AF4979
Species: Hu
Applications: WB
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP2-16372
Species: Hu
Applications: WB, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP1-85608
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for SOCS-5 Antibody (NBP1-85608) (0)

There are no publications for SOCS-5 Antibody (NBP1-85608).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SOCS-5 Antibody (NBP1-85608) (0)

There are no reviews for SOCS-5 Antibody (NBP1-85608). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SOCS-5 Antibody (NBP1-85608) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOCS-5 Products

Bioinformatics Tool for SOCS-5 Antibody (NBP1-85608)

Discover related pathways, diseases and genes to SOCS-5 Antibody (NBP1-85608). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOCS-5 Antibody (NBP1-85608)

Discover more about diseases related to SOCS-5 Antibody (NBP1-85608).
 

Pathways for SOCS-5 Antibody (NBP1-85608)

View related products by pathway.

PTMs for SOCS-5 Antibody (NBP1-85608)

Learn more about PTMs related to SOCS-5 Antibody (NBP1-85608).
 

Research Areas for SOCS-5 Antibody (NBP1-85608)

Find related products by research area.

Blogs on SOCS-5

There are no specific blogs for SOCS-5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOCS-5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOCS5
Entrez