SNAP25 Antibody (4A3)

Images

 
Western Blot: SNAP25 Antibody (4A3) [H00006616-M01] - Analysis of SNAP25 expression in transfected 293T cell line by SNAP25 monoclonal antibody (M01), clone 4A3.Lane 1: SNAP25 transfected lysate(23.315 KDa).Lane 2: ...read more
Sandwich ELISA: SNAP25 Antibody (4A3) [H00006616-M01] - Detection limit for recombinant GST tagged SNAP25 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SNAP25 Antibody (4A3) Summary

Immunogen
SNAP25 (AAH10647, 31 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS
Specificity
SNAP25 - synaptosomal-associated protein, 25kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SNAP25
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SNAP25 Antibody (4A3)

  • bA416N4.2
  • dJ1068F16.2
  • FLJ23079
  • resistance to inhibitors of cholinesterase 4 homolog
  • RIC4
  • RIC-4
  • SEC9
  • SNAP25
  • SNAP-25SNAP
  • SUP
  • Super protein
  • Synaptosomal-associated 25 kDa protein
  • synaptosomal-associated protein 25
  • synaptosomal-associated protein, 25kD
  • synaptosomal-associated protein, 25kDa

Background

Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-595
Species: Mu, Rt, Bv
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-83162
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-86101
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00006616-M01
Species: Hu
Applications: WB, ELISA

Publications for SNAP25 Antibody (H00006616-M01) (0)

There are no publications for SNAP25 Antibody (H00006616-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNAP25 Antibody (H00006616-M01) (0)

There are no reviews for SNAP25 Antibody (H00006616-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SNAP25 Antibody (H00006616-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SNAP25 Products

Bioinformatics Tool for SNAP25 Antibody (H00006616-M01)

Discover related pathways, diseases and genes to SNAP25 Antibody (H00006616-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SNAP25 Antibody (H00006616-M01)

Discover more about diseases related to SNAP25 Antibody (H00006616-M01).
 

Pathways for SNAP25 Antibody (H00006616-M01)

View related products by pathway.

PTMs for SNAP25 Antibody (H00006616-M01)

Learn more about PTMs related to SNAP25 Antibody (H00006616-M01).
 

Research Areas for SNAP25 Antibody (H00006616-M01)

Find related products by research area.

Blogs on SNAP25.

Characterizing Synaptophysin is "a Snap"
Synaptophysin is an integral membrane glycoprotein found within the small synaptic vesicles in brain and endocrine cells. Studies with synaptophysin antibodies show that it is one of the most abundant small vesicle proteins, constituting approximately...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNAP25 Antibody (4A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol SNAP25
Entrez
OMIM
Uniprot