SNAP25 Antibody (4A3) Summary
| Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen |
SNAP25 (AAH10647, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAIS |
| Specificity |
SNAP25 - synaptosomal-associated protein, 25kDa |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SNAP25 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
| Application Notes |
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for SNAP25 Antibody (4A3)
Background
Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC, WB
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA
Publications for SNAP25 Antibody (H00006616-M01) (0)
There are no publications for SNAP25 Antibody (H00006616-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SNAP25 Antibody (H00006616-M01) (0)
There are no reviews for SNAP25 Antibody (H00006616-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SNAP25 Antibody (H00006616-M01) (0)