NAPG Antibody

Images

 
Western Blot: NAPG Antibody [NBP1-86101] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: NAPG Antibody [NBP1-86101] - Staining of human skeletal muscle shows low expression as expected.
Western Blot: NAPG Antibody [NBP1-86101] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: NAPG Antibody [NBP1-86101] - Staining of human cerebral cortex shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NAPG Antibody [NBP1-86101] - Staining in human cerebral cortex and skeletal muscle tissues using anti-NAPG antibody. Corresponding NAPG RNA-seq data are ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

NAPG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLG
Specificity
Specificity of human, mouse, rat NAPG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAPG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NAPG Protein (NBP1-86101PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAPG Antibody

  • gamma SNAP
  • GAMMASNAP
  • gamma-soluble NSF attachment protein
  • N-ethylmaleimide-sensitive factor attachment protein gamma
  • N-ethylmaleimide-sensitive factor attachment protein, gamma
  • SNAPG
  • SNAP-gamma
  • soluble NSF attachment protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88769
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87035
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-595
Species: Mu, Rt, Bv, Pm
Applications: WB, Flow, IHC, IHC-P, IP, IF
NB300-510
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
NBP1-32493
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33414
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7237
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-20434
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt, Pl
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KD
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF4828
Species: Hu, Mu
Applications: WB, IHC
NBP2-66777
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB2568
Species: Mu
Applications: WB, IHC
NBP2-82090
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for NAPG Antibody (NBP1-86101) (0)

There are no publications for NAPG Antibody (NBP1-86101).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAPG Antibody (NBP1-86101) (0)

There are no reviews for NAPG Antibody (NBP1-86101). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NAPG Antibody (NBP1-86101) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NAPG Products

Bioinformatics Tool for NAPG Antibody (NBP1-86101)

Discover related pathways, diseases and genes to NAPG Antibody (NBP1-86101). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NAPG Antibody (NBP1-86101)

Discover more about diseases related to NAPG Antibody (NBP1-86101).
 

Pathways for NAPG Antibody (NBP1-86101)

View related products by pathway.

PTMs for NAPG Antibody (NBP1-86101)

Learn more about PTMs related to NAPG Antibody (NBP1-86101).

Blogs on NAPG

There are no specific blogs for NAPG, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAPG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAPG