Syntaxin 1A Antibody (2B2F10)

Western Blot: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Western blot analysis of extracts of Rat brain, using Syntaxin 1A antibody (NBP3-15706) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.

Western Blot: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Western blot analysis of extracts of various cell lines, using Syntaxin 1A antibody (NBP3-15706) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunohistochemistry-Paraffin: Syntaxin 1A Antibody (2B2F10) [NBP3-15706] - Immunohistochemistry of paraffin-embedded mouse brain using Syntaxin 1A Rabbit mAb (NBP3-15706) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: Syntaxin 1A Antibody (2B2F10) [Syntaxin 1A] - Immunofluorescence analysis of paraffin-embedded rat brain using Syntaxin 1A Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Syntaxin 1A Antibody (2B2F10) [Syntaxin 1A] - Immunofluorescence analysis of paraffin-embedded mouse brain using Syntaxin 1A Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ELISA, ICC/IF, IHC
• Clone: 2B2F10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Syntaxin 1A Antibody (2B2F10) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Syntaxin 1A (Q16623). MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSI
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: STX1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Simple Western 1:20 - 1:250
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Syntaxin 1A Antibody (2B2F10)

• Brain Syntaxin
• HPC-1
• Neuron-specific antigen HPC-1
• p35-1
• STX1A
• STX1P35-1
• SYN1A
• syntaxin 1A (brain)
• Syntaxin 1A
• syntaxin-1A

Background

Synaptic vesicles store neurotransmitters that are released during calcium-regulated exocytosis. The specificity of neurotransmitter release requires the localization of both synaptic vesicles and calcium channels to the presynaptic active zone. Syntaxins function in this vesicle fusion process. Syntaxins also serve as a substrate for botulinum neurotoxin type C, a metalloprotease that blocks exocytosis and has high affinity for a molecular complex that includes the alpha-latrotoxin receptor (MIM 600565) which produces explosive exocytosis (Zhang et al., 1995 [PubMed 7622072]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STX1A