SMURF1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SMURF1 Antibody [NBP3-17934] - Staining of human cell line A-431 shows localization to nucleoplasm & vesicles.

ChIP-Exo-Seq composite graph for Anti-SMURF1 (NBP3-17934) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMURF1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SMURF1 Antibody - BSA Free (NBP3-17934) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMURF1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMURF1 Antibody - BSA Free

• E3 ubiquitin ligase SMURF1
• EC 6.3.2
• EC 6.3.2.-
• hSMURF1
• KIAA1625
• KIAA1625E3 ubiquitin-protein ligase SMURF1
• SMAD specific E3 ubiquitin protein ligase 1
• SMAD ubiquitination regulatory factor 1
• Smad-specific E3 ubiquitin ligase 1
• SMAD-specific E3 ubiquitin-protein ligase 1
• SMURF1

Background

SMURF1 encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. A similar protein in Xenopus is involved in embryonic pattern formation. Alternative splicing results in multiple transcript variants encoding different isoforms. An additional transcript variant has been identified, but its full length sequence has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMURF1