Smoothelin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SMTN |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
- Simple Western 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. See Simple Western Antibody Database for Simple Western validation: Tested in Bladder, separated by Size, antibody dilution of 1:50 |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Smoothelin Antibody - BSA Free
Background
Smoothelin is a constituent of the smooth muscle cell (SMC) cytoskeleton. Antibodies directed to smoothelin are a useful tool to monitor SMC differentiation. Smoothelin is exclusively expressed in fully differentiated (contractile) SMCs. RNA and protein analyses reveal a broad species distribution of this protein. Cells with SMC like characteristics, such as myofibroblasts, myoepithelial cells, and skeletal and cardiac muscle do not contain smoothelin. Confocal scanning laser microscopy of tissue sections, as well as transfection studies, show a filamentous organization of smoothelin that is different from that of desmin and vimentin. Smoothelin colocalizes with actin stress fibers. Two tissue specific isoforms have been identified: a 59 kDa isoform specific for visceral SMC; and a 100 kDa specific for vascular SMC. Human smoothelin is encoded by a single copy gene which is located on chromosome 22. The distribution of smoothelin positive cells indicates a correlation between smoothelin expression and smooth muscle tissue contractility. Smoothelin is a useful tool in the evaluation of atherosclerotic lesions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
Species: Hu, Mu
Applications: WB
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Rt
Applications: IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ELISA
Publications for Smoothelin Antibody (NBP2-37971)(2)
Showing Publications 1 -
2 of 2.
| Publications using NBP2-37971 |
Applications |
Species |
| Salemi S, Schori L, Gerwinn T et al. Myostatin Overexpression and Smad Pathway in Detrusor Derived from Pediatric Patients with End-Stage Lower Urinary Tract Dysfunction International Journal of Molecular Sciences 2023-02-24 [PMID: 36901894] |
|
|
| Lien M. Reolizo, Helen Williams, Kerry Wadey, Aleksandra Frankow, Ze Li, Kevin Gaston, Padma-Sheela Jayaraman, Jason L. Johnson, Sarah J. George Inhibition of Intimal Thickening By PRH (Proline-Rich Homeodomain) in Mice Arteriosclerosis, Thrombosis, and Vascular Biology 2023-01-26 [PMID: 36700427] |
|
|
Reviews for Smoothelin Antibody (NBP2-37971) (0)
There are no reviews for Smoothelin Antibody (NBP2-37971).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Smoothelin Antibody (NBP2-37971) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Smoothelin Products
Blogs on Smoothelin