Smoothelin Antibody - BSA Free

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Analysis in human prostate and liver tissues. Corresponding Smoothelin RNA-seq data are presented for the same tissues.

Western Blot: Smoothelin Antibody [NBP2-37971] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human prostate shows moderate to strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human rectum shows moderate to strong cytoplasmic positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: Smoothelin Antibody [NBP2-37971] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Smoothelin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Smoothelin Antibody - BSA Free (NBP2-37971) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-Smoothelin Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PVARSEEPGAPLPVAVGTAEPGGSMKTTFTIEIKDGRGQASTGRVLLPTGNQRAELTLGLRAPPTLLSTSSGGKSTITRVNSPGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMTN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  See Simple Western Antibody Database for Simple Western validation: Tested in Bladder, separated by Size, antibody dilution of 1:50
• Control Peptide:

  Smoothelin Protein (NBP2-37971PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Smoothelin Antibody - BSA Free

• FLJ35365
• FLJ38597
• Smoothelin
• SMSMO
• SMTN

Background

Smoothelin is a constituent of the smooth muscle cell (SMC) cytoskeleton. Antibodies directed to smoothelin are a useful tool to monitor SMC differentiation. Smoothelin is exclusively expressed in fully differentiated (contractile) SMCs. RNA and protein analyses reveal a broad species distribution of this protein. Cells with SMC like characteristics, such as myofibroblasts, myoepithelial cells, and skeletal and cardiac muscle do not contain smoothelin. Confocal scanning laser microscopy of tissue sections, as well as transfection studies, show a filamentous organization of smoothelin that is different from that of desmin and vimentin. Smoothelin colocalizes with actin stress fibers. Two tissue specific isoforms have been identified: a 59 kDa isoform specific for visceral SMC; and a 100 kDa specific for vascular SMC. Human smoothelin is encoded by a single copy gene which is located on chromosome 22. The distribution of smoothelin positive cells indicates a correlation between smoothelin expression and smooth muscle tissue contractility. Smoothelin is a useful tool in the evaluation of atherosclerotic lesions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Smoothelin Antibody (NBP2-37971)(2)

Publications using NBP2-37971

• Salemi S, Schori L, Gerwinn T et al. Myostatin Overexpression and Smad Pathway in Detrusor Derived from Pediatric Patients with End-Stage Lower Urinary Tract Dysfunction International Journal of Molecular Sciences 2023-02-24 [PMID: 36901894]
• Lien M. Reolizo, Helen Williams, Kerry Wadey, Aleksandra Frankow, Ze Li, Kevin Gaston, Padma-Sheela Jayaraman, Jason L. Johnson, Sarah J. George Inhibition of Intimal Thickening By PRH (Proline-Rich Homeodomain) in Mice Arteriosclerosis, Thrombosis, and Vascular Biology 2023-01-26 [PMID: 36700427]

Bioinformatics

• Gene Symbol: SMTN
• Uniprot:
  • P53814()