SMNDC1 Antibody - Azide and BSA Free

Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in human placenta.

Immunocytochemistry/Immunofluorescence: SMNDC1 Antibody [H00010285-B01P] - Analysis of purified antibody to SMNDC1 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in PC-12.

Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in Raw 264.7.

Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in A-431.

Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in NIH/3T3.

Western Blot: SMNDC1 Antibody [H00010285-B01P] - Analysis of SMNDC1 expression in transfected 293T cell line by SMNDC1 polyclonal antibody. Lane 1: SMNDC1 transfected lysate(26.18 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SMNDC1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SMNDC1 Antibody - Azide and BSA Free (H00010285-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SMNDC1 (NP_005862.1, 1 a.a. - 238 a.a.) full-length human protein. MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ
• Specificity: SMNDC1 - survival motor neuron domain containing 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: SMNDC1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It is also useful for immunofluoresence.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMNDC1 Antibody - Azide and BSA Free

• SMNRSMN-related protein
• SPF30splicing factor 30, survival of motor neuron-related
• survival motor neuron domain containing 1,30 kDa splicing factor SMNrp
• Survival motor neuron domain-containing protein 1
• survival of motor neuron-related-splicing factor 30

Background

This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMNDC1
• Entrez:
  • 10285(Human)
• Uniprot:
  • NP_005862.1(Human)