SNRPD3 Antibody - BSA Free

Western Blot: SNRPD3 Antibody [NBP1-80735] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-SNRPD3 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.

Immunocytochemistry/Immunofluorescence: SNRPD3 Antibody [NBP1-80735] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.

Immunohistochemistry-Paraffin: SNRPD3 Antibody [NBP1-80735] - Immunohistochemical staining of human small intestine shows moderate to strong nuclear positivity in glandular cells.

Western Blot: SNRPD3 Antibody [NBP1-80735] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: SNRPD3 Antibody [NBP1-80735] - Immunohistochemical staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: SNRPD3 Antibody [NBP1-80735] - Immunohistochemical staining of human prostate shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SNRPD3 Antibody [NBP1-80735] - Immunohistochemical staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNRPD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNRPD3 Antibody - BSA Free (NBP1-80735) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SNRPD3 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNRPD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100
• Control Peptide:

  SNRPD3 Protein (NBP1-80735PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNRPD3 Antibody - BSA Free

• small nuclear ribonucleoprotein D3 polypeptide 18kDa
• small nuclear ribonucleoprotein Sm D3
• snRNP core protein D3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SNRPD3 Antibody (NBP1-80735)(4)

Publications using NBP1-80735

• Milara J, MartInez-ExpOsito F, Montero P et al. N-acetylcysteine Reduces Inflammasome Activation Induced by SARS-CoV-2 Proteins In Vitro International Journal of Molecular Sciences 2022-11-22 [PMID: 36498845] (IHC-P, Human)
  
  Details:
  differentiated 937 macrophages were stimulated
• Czarnek M, Sarad K, Kara? A et al. Non-targeting control for MISSION shRNA library silences SNRPD3 leading to cell death or permanent growth arrest Molecular Therapy - Nucleic Acids 2021-12-03 [PMID: 34703654]
• Elayne Chan-Penebre, Kristy G Kuplast, Christina R Majer et al. A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models. Nature Chemical Biology 2015-04-27 [PMID: 25915199] (Human)
• Xie W, Denman RB et al. Protein methylation and stress granules: posttranslational remodeler or innocent bystander?. Mol Biol Int 2011-01-01 [PMID: 22091395]

Bioinformatics

• Gene Symbol: SNRPD3
• Entrez:
  • 6634(Human)
• Uniprot:
  • P62318(Human)