PRPF3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: PRPF3 Antibody [NBP3-38160] - Immunofluorescence analysis of U2OS cells using PRPF3 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: PRPF3 Antibody [NBP3-38160] - Western blot analysis of lysates from THP-1 cells, using PRPF3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 60s.

Immunohistochemistry: PRPF3 Antibody [NBP3-38160] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using PRPF3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: PRPF3 Antibody [NBP3-38160] - Immunohistochemistry analysis of paraffin-embedded Rat brain using PRPF3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: PRPF3 Antibody [NBP3-38160] - Immunohistochemistry analysis of paraffin-embedded Human stomach using PRPF3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRPF3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRPF3 Antibody - BSA Free (NBP3-38160) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PRPF3 (NP_004689.1).
  
  Sequence:
  MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRPF3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 1:50 - 1:100
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 78 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRPF3 Antibody - BSA Free

• hPrp3
• HPRP3P
• HPRP3retinitis pigmentosa 18 (autosomal dominant)
• Pre-mRNA-splicing factor 3
• PRP3 pre-mRNA processing factor 3 homolog (S. cerevisiae)
• PRP3 pre-mRNA processing factor 3 homolog (yeast)
• PRP3
• Prp3p
• RP18
• U4/U6 small nuclear ribonucleoprotein Prp3
• U4/U6 snRNP 90 kDa protein
• U4/U6-associated RNA splicing factor

Background

The removal of introns from nuclear pre-mRNAs occurs on complexes called spliceosomes, which are made up of 4 small nuclear ribonucleoprotein (snRNP) particles and an undefined number of transiently associated splicing factors. This gene product is one of several proteins that associate with U4 and U6 snRNPs. Mutations in this gene are associated with retinitis pigmentosa-18. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRPF3