SMCHD1 Antibody

Images

 
Western Blot: SMCHD1 Antibody [NBP1-82978] - Analysis in human cell lines U2OS and MCF-7 using Anti-SMCHD1 antibody. Corresponding SMCHD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Immunocytochemistry/ Immunofluorescence: SMCHD1 Antibody [NBP1-82978] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SMCHD1 Antibody [NBP1-82978] - Staining of human duodenum shows nucelar positivity in glandular cells.
Western Blot: SMCHD1 Antibody [NBP1-82978] - Analysis in human cell line HL-60.
Simple Western: SMCHD1 Antibody [NBP1-82978] - Simple Western lane view shows a specific band for SMCHD1 in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more
Simple Western: SMCHD1 Antibody [NBP1-82978] - Electropherogram image(s) of corresponding Simple Western lane view. SMCHD1 antibody was used at 1:40 dilution on RT-4 lysates(s).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

SMCHD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMCHD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:40
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
SMCHD1 Protein (NBP1-82978PEP)
Publications
Read Publication using NBP1-82978.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23143600)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMCHD1 Antibody

  • DKFZp686O0631
  • KIAA0650
  • structural maintenance of chromosomes flexible hinge domain containing 1
  • structural maintenance of chromosomes flexible hinge domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-55310
Species: Hu, Mu
Applications: WB, IP
NBP1-49552
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-27098
Species: Hu, Pm
Applications: WB, IHC-P
NB120-13888
Species: Hu, Mu
Applications: WB, ChIP, Flow, ICC/IF, IHC-P, CyTOF-ready, IHC-WhMt
NB100-266
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-279
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP2-32901
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84146
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SMCHD1 Antibody (NBP1-82978)(1)

Reviews for SMCHD1 Antibody (NBP1-82978) (0)

There are no reviews for SMCHD1 Antibody (NBP1-82978). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMCHD1 Antibody (NBP1-82978) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMCHD1 Products

Bioinformatics Tool for SMCHD1 Antibody (NBP1-82978)

Discover related pathways, diseases and genes to SMCHD1 Antibody (NBP1-82978). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMCHD1 Antibody (NBP1-82978)

Discover more about diseases related to SMCHD1 Antibody (NBP1-82978).
 

Pathways for SMCHD1 Antibody (NBP1-82978)

View related products by pathway.

PTMs for SMCHD1 Antibody (NBP1-82978)

Learn more about PTMs related to SMCHD1 Antibody (NBP1-82978).
 

Research Areas for SMCHD1 Antibody (NBP1-82978)

Find related products by research area.

Blogs on SMCHD1

There are no specific blogs for SMCHD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMCHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMCHD1