SMARCA5/SNF2H Antibody

Images

 
Genetic Strategies: Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SMARCA5 antibody. Remaining ...read more
Immunocytochemistry/ Immunofluorescence: SMARCA5/SNF2H Antibody [NBP1-89692] - Staining of human cell line A-431 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SMARCA5/SNF2H Antibody [NBP1-89692] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in human cell line MOLT-4.
Western Blot: SMARCA5/SNF2H Antibody [NBP1-89692] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

SMARCA5/SNF2H Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSAAEPPPPPPPESAPSKPAASIASGGSNSSNKGGPEGVAAQAVASAASAGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPA
Specificity
Specificity of human SMARCA5/SNF2H antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMARCA5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMARCA5/SNF2H Protein (NBP1-89692PEP)
Publications
Read Publication using NBP1-89692.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23240041)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMARCA5/SNF2H Antibody

  • EC 3.6.1
  • EC 3.6.4.-
  • hISWI
  • hSNF2HSWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5
  • ISWI
  • SMARCA5
  • SNF2H
  • SNF2Hsucrose nonfermenting-like 5
  • subfamily a, member 5
  • Sucrose nonfermenting protein 2 homolog
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 5
  • WCRF135

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP
NB100-61041
Species: Hu
Applications: WB, IP
NBP3-03399
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-59281
Species: Hu
Applications: WB, ICC/IF, IP, IF
NBP1-90271
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-91988
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-56519
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
NB100-41418
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB21-2024
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBP1-89692
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for SMARCA5/SNF2H Antibody (NBP1-89692)(1)


Reviews for SMARCA5/SNF2H Antibody (NBP1-89692) (0)

There are no reviews for SMARCA5/SNF2H Antibody (NBP1-89692). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMARCA5/SNF2H Antibody (NBP1-89692) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMARCA5/SNF2H Products

Bioinformatics Tool for SMARCA5/SNF2H Antibody (NBP1-89692)

Discover related pathways, diseases and genes to SMARCA5/SNF2H Antibody (NBP1-89692). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCA5/SNF2H Antibody (NBP1-89692)

Discover more about diseases related to SMARCA5/SNF2H Antibody (NBP1-89692).
 

Pathways for SMARCA5/SNF2H Antibody (NBP1-89692)

View related products by pathway.

PTMs for SMARCA5/SNF2H Antibody (NBP1-89692)

Learn more about PTMs related to SMARCA5/SNF2H Antibody (NBP1-89692).

Blogs on SMARCA5/SNF2H

There are no specific blogs for SMARCA5/SNF2H, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMARCA5/SNF2H Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCA5