SMARCD1 Antibody

Images

 
Western Blot: SMARCD1 Antibody [NBP1-88719] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SMARCD1 Antibody [NBP1-88719] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: SMARCD1 Antibody [NBP1-88719] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Western Blot: SMARCD1 Antibody [NBP1-88719] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMARCD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMARCD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMARCD1 Protein (NBP1-88719PEP)
Publications
Read Publication using NBP1-88719.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMARCD1 Antibody

  • BAF60Amammalian chromatin remodeling complex BRG1-associated factor 60A
  • BRG1-associated factor 60A
  • chromatin remodeling complex BAF60A subunit
  • CRACD1
  • Rsc6p
  • subfamily d, member 1
  • SWI/SNF complex 60 kDa subunit A
  • SWI/SNF complex 60 kDa subunit
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 1,60 kDa BRG-1/Brm-associated factor subunit A
  • Swp73-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006604-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90012
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00006603-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
NBP1-88932
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB

Publications for SMARCD1 Antibody (NBP1-88719)(1)

Reviews for SMARCD1 Antibody (NBP1-88719) (0)

There are no reviews for SMARCD1 Antibody (NBP1-88719). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMARCD1 Antibody (NBP1-88719) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMARCD1 Products

Bioinformatics Tool for SMARCD1 Antibody (NBP1-88719)

Discover related pathways, diseases and genes to SMARCD1 Antibody (NBP1-88719). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCD1 Antibody (NBP1-88719)

Discover more about diseases related to SMARCD1 Antibody (NBP1-88719).
 

Pathways for SMARCD1 Antibody (NBP1-88719)

View related products by pathway.

PTMs for SMARCD1 Antibody (NBP1-88719)

Learn more about PTMs related to SMARCD1 Antibody (NBP1-88719).
 

Research Areas for SMARCD1 Antibody (NBP1-88719)

Find related products by research area.

Blogs on SMARCD1

There are no specific blogs for SMARCD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMARCD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCD1