SMARCD2 Antibody (2B2)

Images

 
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2. Analysis of SMARCD2 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: SMARCD2 Antibody (2B2) [H00006603-M02] - Analysis of monoclonal antibody to SMARCD2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 expression in Raw 264.7(Cat # L024V1 ).
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2. Analysis of SMARCD2 expression in PC-12.
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2 Analysis of SMARCD2 expression in Hela S3 NE.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SMARCD2 Antibody (2B2) Summary

Immunogen
SMARCD2 (NP_003068 398 a.a. - 474 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Specificity
SMARCD2 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 (2B2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMARCD2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMARCD2 Antibody (2B2)

  • 60 kDa BRG-1/Brm-associated factor subunit B
  • BAF60B
  • BRG1-associated factor 60B
  • chromatin remodeling complex BAF60B subunit
  • CRACD2
  • mammalian chromatin remodeling complex BRG1-associated factor 60B
  • PRO2451
  • Rsc6p
  • SWI/SNF complex 60 kDa subunit B
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
  • Swp73-like protein

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
H00006604-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF6817
Species: Hu
Applications: WB
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-88719
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00058524-R01
Species: Hu
7668-GH/CF
Species: Hu
MAB6799
Species: Hu
Applications: WB, IHC
H00006603-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for SMARCD2 Antibody (H00006603-M02) (0)

There are no publications for SMARCD2 Antibody (H00006603-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCD2 Antibody (H00006603-M02) (0)

There are no reviews for SMARCD2 Antibody (H00006603-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMARCD2 Antibody (H00006603-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMARCD2 Products

Bioinformatics Tool for SMARCD2 Antibody (H00006603-M02)

Discover related pathways, diseases and genes to SMARCD2 Antibody (H00006603-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCD2 Antibody (H00006603-M02)

Discover more about diseases related to SMARCD2 Antibody (H00006603-M02).
 

Pathways for SMARCD2 Antibody (H00006603-M02)

View related products by pathway.

PTMs for SMARCD2 Antibody (H00006603-M02)

Learn more about PTMs related to SMARCD2 Antibody (H00006603-M02).
 

Research Areas for SMARCD2 Antibody (H00006603-M02)

Find related products by research area.

Blogs on SMARCD2

There are no specific blogs for SMARCD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMARCD2 Antibody (2B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCD2
Entrez