Home » SMARCD2 » SMARCD2 Antibodies » SMARCD2 Antibody (2B2)

SMARCD2 Antibody (2B2)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2. Analysis of SMARCD2 expression in NIH/3T3.
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2. Analysis of SMARCD2 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: SMARCD2 Antibody (2B2) [H00006603-M02] - Analysis of monoclonal antibody to SMARCD2 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 expression in Raw 264.7(Cat # L024V1 ).
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2. Analysis of SMARCD2 expression in PC-12.
Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2 Analysis of SMARCD2 expression in Hela S3 NE.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
2B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SMARCD2 Antibody (2B2) Summary

Immunogen
SMARCD2 (NP_003068 398 a.a. - 474 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
Specificity
SMARCD2 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 (2B2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMARCD2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.
Publications
Read Publication using H00006603-M02.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMARCD2 Antibody (2B2)

  • 60 kDa BRG-1/Brm-associated factor subunit B
  • BAF60B
  • BRG1-associated factor 60B
  • chromatin remodeling complex BAF60B subunit
  • CRACD2
  • mammalian chromatin remodeling complex BRG1-associated factor 60B
  • PRO2451
  • Rsc6p
  • SWI/SNF complex 60 kDa subunit B
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
  • Swp73-like protein

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SMARCA1 Antibody
(2H7B8)
NBP2-61879
Western Blot: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis using SMARCA1 mAb against HEK293 (1) and SMARCA1 (AA: 933-1070)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of paraffin-embedded rectum cancer tissues using SMARCA1 mouse mAb with DAB staining.
Flow Cytometry: SMARCA1 Antibody (2H7B8) [NBP2-61879] - Analysis of NIH/3T3 cells using SMARCA1 mouse mAb (green) and negative control (red).
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
Brg1 Antibody
NB100-2594
Western Blot: Brg1 Antibody [NB100-2594] - Detection of Human and Mouse BRG1/SMARCA4 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells. Antibodies: Affinity purified rabbit anti-BRG1/SMARCA4 antibody NB100-2594 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunohistochemistry: Brg1 Antibody [NB100-2594] - Sample: FFPE section of mouse plasmacytoma. Antibody: Affinity purified rabbit anti-BRG1/SMARCA4 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB staining using Immunohistochemistry Accessory Kit.
Western Blot: Brg1 Antibody [NB100-2594] - Detection of Human and Mouse BRG1/SMARCA4 on HeLa whole cell lysate using NB100-2594.
(4 Publications)
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
Growth Hormone
Antibody [Unconjugate
AF1067
Growth Hormone was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
BRM Antibody
NBP1-90015
Immunocytochemistry/Immunofluorescence: BRM Antibody [NBP1-90015] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BRM Antibody [NBP1-90015] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: BRM Antibody [NBP1-90015] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SUG1 Antibody
(25D5)
NB100-345
Western Blot: SUG1 Antibody (25D5) [NB100-345] - SUG1 antibody with 30 ug whole cell lysate run on SDS-PAGE. Lane A: 293T; B: A431; C: H1299; D: Hela; E: Hep G2; F: Molt-4; G: Raji 10% SDS PAGE diluted at 1:1000
(2 Reviews)
(4 Publications)
Species: Hu
Applications: WB, ChIP, IP
SMARCD3 Antibody
(1G6)
H00006604-M01
Western Blot: SMARCD3 Antibody (1G6) [H00006604-M01] - SMARCD3 monoclonal antibody (M01), clone 1G6 Analysis of SMARCD3 expression in K-562.
Immunocytochemistry/Immunofluorescence: SMARCD3 Antibody (1G6) [H00006604-M01] - Analysis of monoclonal antibody to SMARCD3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: SMARCD3 Antibody (1G6) [H00006604-M01] - Detection limit for recombinant GST tagged SMARCD3 is approximately 0.3ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF
SMARCC1 Antibody
NBP2-20415
Western Blot: SMARCC1 Antibody [NBP2-20415] - Various whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with SMARCC1 antibody [C2C3], C-term diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: SMARCC1 Antibody [NBP2-20415] - SK-N-SH cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: SMARCC1 protein stained by SMARCC1 antibody (C2C3), C-term diluted at 1:500. Red-Phalloidin, a cytoskeleton marker- diluted at 1:200. Scale bar = 10 um.
Immunohistochemistry-Paraffin: SMARCC1 Antibody [NBP2-20415] - Paraffin-embedded rat hind brain dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Recombinant Human
gamma-glutamyl hydrol ...
NBP1-78898
SDS-Page: Recombinant Human gamma-glutamyl hydrolase Protein [NBP1-78898]
Species: Hu
SNF5 Antibody
(3E10.)
H00006598-M01
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10. Analysis of SMARCB1 expression in Raw 264.7.
Immunohistochemistry-Paraffin: SNF5 Antibody (3E10) [H00006598-M01] - Analysis of monoclonal antibody to SMARCB1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.
Western Blot: SNF5 Antibody (3E10) [H00006598-M01] - SMARCB1 monoclonal antibody (M01), clone 3E10 Analysis of SMARCB1 expression in PC-12.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
Caspase-1 Antibody
(14F468)
NB100-56565
Western Blot: Caspase-1 Antibody (14F468) [NB100-56565] - Analysis of Caspase-1 using a Caspase-1 monoclonal antibody. Human HeLa (A) and mouse NIH3T3 lysate probed with Caspase-1 antibody at 0.5 ug/ml and 2 ug/ml, respectively.
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - IHC analysis of a formalin fixed paraffin embedded (FFPE) tissue section of human intestine using Caspase-1 antibody (clone 14F468) at 5ug/ml concentration (1:200 dilution). The primary antibody binding to Caspase 1 in cells was detected using HRP conjugated anti-Mouse secondary antibody with DAB reagent, and the sections were further counterstained with hematoxylin for labeling cellular nuclei. This Caspase 1 antibody generated a diffused but specific cytoplasmic staining in columnar epithelia cells of villi, and a few cells depicted nuclear staining also. Only a subset of connective tissue cells in lamina propria depicted positivity (cytoplasmic) for this protein.
Immunohistochemistry-Paraffin: Caspase-1 Antibody (14F468) [NB100-56565] - Formalin-fixed, paraffin-embedded adenocarcinoma of the rectum stained with Caspase-1 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(25 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Nuclear Factor
Erythroid Derived 2 A ...
NBP1-82580
Western Blot: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Analysis in human cell line HEL.
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining in human bone marrow and liver tissues. Corresponding NFE2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Nuclear Factor Erythroid Derived 2 Antibody [NBP1-82580] - Staining of human bone marrow shows moderate to strong nuclear positivity in hematopoietic cells.
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Skp2 Antibody
NBP2-29923
Western Blot: Skp2 Antibody [NBP2-29923] - SKP2 Antibody (Center) (NBP2-29923) in Hela cell line lysates (35ug/lane). SKP2 (arrow) was detected using the purified Pab.
Flow Cytometry: Skp2 Antibody [NBP2-29923] - Hela cells using SKP2 Antibody (Center)(bottom histogram) compared to a negative control cell (top histogram). FITC-conjugated goat-anti-rabbit secondary
Species: Hu
Applications: WB, Flow
Growth Hormone
Antibody [Unconjugate
AF1067
Growth Hormone was detected in immersion fixed paraffin-embedded sections of human pituitary using Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
SMARCD1 Antibody
NBP1-88719
Western Blot: SMARCD1 Antibody [NBP1-88719] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: SMARCD1 Antibody [NBP1-88719] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: SMARCD1 Antibody [NBP1-88719] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SMARCC2/BAF170
Antibody
NBP1-90017
Western Blot: SMARCC2/BAF170 Antibody [NBP1-90017] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: SMARCC2/BAF170 Antibody [NBP1-90017] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SMARCC2/BAF170 Antibody [NBP1-90017] - Staining of human stomach shows strong nuclear positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
BANF1 Antibody
NBP2-38442
Immunocytochemistry/Immunofluorescence: BANF1 Antibody [NBP2-38442] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442] - Staining in human fallopian tube and pancreas tissues using anti-BANF1 antibody. Corresponding BANF1 RNA-seq data are presented for the same tissues.
Immunohistochemistry: BANF1 Antibody [NBP2-38442] - Staining of human cerebellum shows distinct nuclear membrane positivity in Purkinje cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
DMRT3 Protein
H00058524-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Growth Hormone 2
7668-GH/CF
Growth Hormone 2
Species: Hu
Pan PSG Antibody
(684701) [Unconjugate ...
MAB6799
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human PSG Pan Specific Monoclonal Antibody (Catalog # MAB6799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PSG at approximately 72 and 64 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
PSG was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human PSG Pan Specific Mono­clonal Antibody (Catalog # MAB6799) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific staining was localized to cytotrophoblast cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: WB, IHC
SMARCD2 Antibody
(2B2)
H00006603-M02
SMARCD2 Antibody (2B2)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF

Publications for SMARCD2 Antibody (H00006603-M02)(1)


Reviews for SMARCD2 Antibody (H00006603-M02) (0)

There are no reviews for SMARCD2 Antibody (H00006603-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMARCD2 Antibody (H00006603-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMARCD2 Products

Bioinformatics Tool for SMARCD2 Antibody (H00006603-M02)

Discover related pathways, diseases and genes to SMARCD2 Antibody (H00006603-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMARCD2 Antibody (H00006603-M02)

Discover more about diseases related to SMARCD2 Antibody (H00006603-M02).
 

Pathways for SMARCD2 Antibody (H00006603-M02)

View related products by pathway.

PTMs for SMARCD2 Antibody (H00006603-M02)

Learn more about PTMs related to SMARCD2 Antibody (H00006603-M02).
 

Research Areas for SMARCD2 Antibody (H00006603-M02)

Find related products by research area.

Blogs on SMARCD2

There are no specific blogs for SMARCD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMARCD2 Antibody (2B2) and receive a gift card or discount.


Bioinformatics

Gene Symbol SMARCD2
Entrez