SMARCD2 Antibody (2B2)

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2. Analysis of SMARCD2 expression in NIH/3T3.

Immunocytochemistry/Immunofluorescence: SMARCD2 Antibody (2B2) [H00006603-M02] - Analysis of monoclonal antibody to SMARCD2 on HeLa cell. Antibody concentration 10 ug/ml.

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 expression in Raw 264.7(Cat # L024V1 ).

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2. Analysis of SMARCD2 expression in PC-12.

Western Blot: SMARCD2 Antibody (2B2) [H00006603-M02] - SMARCD2 monoclonal antibody (M02), clone 2B2 Analysis of SMARCD2 expression in Hela S3 NE.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 2B2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

SMARCD2 Antibody (2B2) Summary

• Immunogen: SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL
• Specificity: SMARCD2 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 (2B2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SMARCD2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
• Application Notes: Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMARCD2 Antibody (2B2)

• 60 kDa BRG-1/Brm-associated factor subunit B
• BAF60B
• BRG1-associated factor 60B
• chromatin remodeling complex BAF60B subunit
• CRACD2
• mammalian chromatin remodeling complex BRG1-associated factor 60B
• PRO2451
• Rsc6p
• SWI/SNF complex 60 kDa subunit B
• SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
• SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
• Swp73-like protein

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMARCD2 Antibody (H00006603-M02)(1)

Publication using H00006603-M02

• Ji S, Zhu L, Gao Y et al. Baf60b-mediated ATM-p53 activation blocks cell identity conversion by sensing chromatin opening. Cell Res 2017 Mar 17 [PMID: 28303890]

Bioinformatics

• Gene Symbol: SMARCD2
• Entrez:
  • 6603(Human)