SMARCD3 Antibody (1G6)

Images

 
Western Blot: SMARCD3 Antibody (1G6) [H00006604-M01] - SMARCD3 monoclonal antibody (M01), clone 1G6 Analysis of SMARCD3 expression in K-562.
Immunocytochemistry/ Immunofluorescence: SMARCD3 Antibody (1G6) [H00006604-M01] - Analysis of monoclonal antibody to SMARCD3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: SMARCD3 Antibody (1G6) [H00006604-M01] - Detection limit for recombinant GST tagged SMARCD3 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SMARCD3 Antibody (1G6) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Specificity
SMARCD3 - SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMARCD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publications using H00006604-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SMARCD3 Antibody (1G6)

  • 60 kDa BRG-1/Brm-associated factor subunit C
  • 60kDa BRG-1/Brm associated factor subunit c
  • BAF60Cchromatin remodeling complex BAF60C subunit
  • BRG1-associated factor 60C
  • CRACD3
  • mammalian chromatin remodeling complex BRG1-associated factor 60C
  • MGC111010
  • Rsc6p
  • subfamily d, member 3
  • SWI/SNF complex 60 kDa subunit C
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3
  • Swp73-like protein

Background

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMARCD3 Antibody (H00006604-M01)(3)

Reviews for SMARCD3 Antibody (H00006604-M01) (0)

There are no reviews for SMARCD3 Antibody (H00006604-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMARCD3 Antibody (H00006604-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMARCD3 Antibody (1G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMARCD3
Entrez
OMIM
Uniprot