ARID1A Antibody

Images

 
Western Blot: ARID1A Antibody [NBP1-88932] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: ARID1A Antibody [NBP1-88932] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human colorectal cancer shows weak to moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human lymph node shows moderate nuclear positivity in lymphoid cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARID1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARID1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARID1A Protein (NBP1-88932PEP)
Publications
Read Publications using
NBP1-88932 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%). Human reactivity reported in scientific literature (PMID: 22585168). Mouse reactivity reported in the scientific literature (PMID: 25653835).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARID1A Antibody

  • ARID domain-containing protein 1A
  • AT rich interactive domain 1A (SWI- like)
  • AT rich interactive domain 1A (SWI-like)
  • AT-rich interactive domain-containing protein 1A
  • B120SWI-like protein
  • BAF250a
  • BAF250SWI/SNF complex protein p270
  • BM029
  • brain protein 120
  • BRG1-associated factor 250
  • BRG1-associated factor 250a
  • C10rf4
  • C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1
  • chromatin remodeling factor p250
  • hELD
  • hOSA1
  • matrix associated, actin dependent regulator of chromatin
  • Osa homolog 1
  • OSA1 nuclear protein
  • OSA1
  • P270
  • SMARCF1
  • subfamily f, member 1

Background

ARID1A encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain ARID1A genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARID1A Antibody (NBP1-88932)(23)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(12)
All Applications
Filter By Species
Human
(10)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 23. Show All 23 Publications.
Publications using NBP1-88932 Applications Species
Markowska A, Szarszewska M et al. The role of nesfatin and selected molecular factors in various types of endometrial cancer. Ginekol Pol 2019-07-11 [PMID: 31686413] (IF/IHC, Human) IF/IHC Human
Markowska A, Szarszewska M et al. Studies on selected molecular factors in endometrial cancers. Adv Clin Exp Med 2018-01-10 [PMID: 30277666] (IF/IHC, Human) IF/IHC Human
Abe H, Hayashi A, Kunita A et al. Altered expression of AT-rich interactive domain 1A in hepatocellular carcinoma. Int J Clin Exp Pathol 2015-01-01 [PMID: 26045782] (IF/IHC, Human) IF/IHC Human
Uehara Y, Oda K, Ikeda Y et al. Integrated Copy Number and Expression Analysis Identifies Profiles of Whole-Arm Chromosomal Alterations and Subgroups with Favorable Outcome in Ovarian Clear Cell Carcinomas. PLoS One 2015-01-01 [PMID: 26043110] (IF/IHC, Human) IF/IHC Human
He F, Li J, Xu J et al. Decreased expression of ARID1A associates with poor prognosis and promotes metastases of hepatocellular carcinoma. J Exp Clin Cancer Res 2015-05-15 [PMID: 25975202] (IF/IHC, Human) IF/IHC Human
Inada R, Sekine S, Taniguchi H et al. ARID1A expression in gastric adenocarcinoma: Clinicopathological significance and correlation with DNA mismatch repair status. World J Gastroenterol 2015-02-21 [PMID: 25717252] (IF/IHC, Human) IF/IHC Human
Biter BG, Aird KM, Garipov A et al. Targeting EZH2 methyltransferase activity in ARID1A mutated cancer cells is synthetic lethal. Nat Med 2015-03-01 [PMID: 25686104]
Howat W, Miller J, Gounaris I et al. Application of ARID1A to murine formalin-fixed paraffin embedded tissue using immunohistochemistry. F1000Res 2014-01-01 [PMID: 25653835] (IF/IHC, Mouse) IF/IHC Mouse
Wiegand KC, Hennessy BT, Leung S et al. A functional proteogenomic analysis of endometrioid and clear cell carcinomas using reverse phase protein array and mutation analysis: protein expression is histotype-specific and loss of ARID1A/BAF250a is associated with AKT phosphorylation. BMC Cancer 2014-02-22 [PMID: 24559118]
Wu RC, Ayhan A, Maeda D et al. Frequent somatic mutations of the telomerase reverse transcriptase promoter in ovarian clear cell carcinoma but not in other major types of gynecologic malignancies. J Pathol 2014-03-01 [PMID: 24338723] (IF/IHC, Human) IF/IHC Human
Show All 23 Publications.

Reviews for ARID1A Antibody (NBP1-88932) (0)

There are no reviews for ARID1A Antibody (NBP1-88932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARID1A Antibody (NBP1-88932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARID1A Products

Research Areas for ARID1A Antibody (NBP1-88932)

Find related products by research area.

Blogs on ARID1A

There are no specific blogs for ARID1A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARID1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID1A
Entrez
Uniprot