ARID1A Antibody

Images

 
Western Blot: ARID1A Antibody [NBP1-88932] - Analysis in control (vector only transfected HEK293T lysate) and aRID1A over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: ARID1A Antibody [NBP1-88932] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human colorectal cancer shows weak to moderate nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human duodenum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human fallopian tube shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human cerebral cortex shows moderate to strong nuclear positivity in neuronal cells.
Immunohistochemistry-Paraffin: ARID1A Antibody [NBP1-88932] - Immunohistochemical staining of human lymph node shows moderate nuclear positivity in lymphoid cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARID1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARID1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARID1A Protein (NBP1-88932PEP)
Publications
Read Publications using
NBP1-88932 in the following applications:

  • IHC
    10 publications

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%). Human reactivity reported in scientific literature (PMID: 22585168).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARID1A Antibody

  • ARID domain-containing protein 1A
  • AT rich interactive domain 1A (SWI- like)
  • AT rich interactive domain 1A (SWI-like)
  • AT-rich interactive domain-containing protein 1A
  • B120SWI-like protein
  • BAF250a
  • BAF250SWI/SNF complex protein p270
  • BM029
  • brain protein 120
  • BRG1-associated factor 250
  • BRG1-associated factor 250a
  • C10rf4
  • C1orf4SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatinsubfamily F member 1
  • chromatin remodeling factor p250
  • hELD
  • hOSA1
  • matrix associated, actin dependent regulator of chromatin
  • Osa homolog 1
  • OSA1 nuclear protein
  • OSA1
  • P270
  • SMARCF1
  • subfamily f, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
H00057492-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90015
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00006598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00008815-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-46403
Species: Hu
Applications: IHC
NB100-79833
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90017
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20415
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for ARID1A Antibody (NBP1-88932)(21)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(10)
All Applications
Filter By Species
Human
(8)
Mouse
(1)
All Species
Showing Publications 1 - 10 of 21. Show All 21 Publications.
Publications using NBP1-88932 Applications Species
Abe H, Hayashi A, Kunita A et al. Altered expression of AT-rich interactive domain 1A in hepatocellular carcinoma. Int J Clin Exp Pathol 2015 [PMID: 26045782] (IHC, Human) IHC Human
Uehara Y, Oda K, Ikeda Y et al. Integrated Copy Number and Expression Analysis Identifies Profiles of Whole-Arm Chromosomal Alterations and Subgroups with Favorable Outcome in Ovarian Clear Cell Carcinomas. PLoS One 2015 [PMID: 26043110] (IHC, Human) IHC Human
He F, Li J, Xu J et al. Decreased expression of ARID1A associates with poor prognosis and promotes metastases of hepatocellular carcinoma. J Exp Clin Cancer Res 2015 May 15 [PMID: 25975202] (IHC, Human) IHC Human
Inada R, Sekine S, Taniguchi H et al. ARID1A expression in gastric adenocarcinoma: Clinicopathological significance and correlation with DNA mismatch repair status. World J Gastroenterol 2015 Feb 21 [PMID: 25717252] (IHC, Human) IHC Human
Biter BG, Aird KM, Garipov A et al. Targeting EZH2 methyltransferase activity in ARID1A mutated cancer cells is synthetic lethal. Nat Med 2015 Mar [PMID: 25686104]
Howat W, Miller J, Gounaris I et al. Application of ARID1A to murine formalin-fixed paraffin embedded tissue using immunohistochemistry. F1000Res 2014 [PMID: 25653835] (IHC, Mouse) IHC Mouse
Wiegand KC, Hennessy BT, Leung S et al. A functional proteogenomic analysis of endometrioid and clear cell carcinomas using reverse phase protein array and mutation analysis: protein expression is histotype-specific and loss of ARID1A/BAF250a is associated with AKT phosphorylation. BMC Cancer 2014 Feb 22 [PMID: 24559118]
Wu RC, Ayhan A, Maeda D et al. Frequent somatic mutations of the telomerase reverse transcriptase promoter in ovarian clear cell carcinoma but not in other major types of gynecologic malignancies. J Pathol 2014 Mar [PMID: 24338723] (IHC, Human) IHC Human
Hsien-Neng Huang, Ming-Chieh Lin, Wen-Chih Huang et al. Loss of ARID1A expression and its relationship with PI3K-Akt pathway alterations and ZNF217 amplification in ovarian clear cell carcinoma. Modern Pathology 2015 [PMID: 24336158] (IHC, Human) IHC Human
Mao TL, Ardighieri L, Ayhan A et al. Loss of ARID1A Expression Correlates with Stages of Tumor Progression in Uterine Endometrioid Carcinoma. Am J Surg Pathol 2013 Sep [PMID: 24076775] (IHC) IHC
Show All 21 Publications.

Reviews for ARID1A Antibody (NBP1-88932) (0)

There are no reviews for ARID1A Antibody (NBP1-88932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARID1A Antibody (NBP1-88932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARID1A Products

Bioinformatics Tool for ARID1A Antibody (NBP1-88932)

Discover related pathways, diseases and genes to ARID1A Antibody (NBP1-88932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARID1A Antibody (NBP1-88932)

Discover more about diseases related to ARID1A Antibody (NBP1-88932).
 

Pathways for ARID1A Antibody (NBP1-88932)

View related products by pathway.

PTMs for ARID1A Antibody (NBP1-88932)

Learn more about PTMs related to ARID1A Antibody (NBP1-88932).
 

Research Areas for ARID1A Antibody (NBP1-88932)

Find related products by research area.

Blogs on ARID1A

There are no specific blogs for ARID1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARID1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARID1A
Entrez
Uniprot