Smad7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Smad7 Antibody [NBP1-87728] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center, cytosol and centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Smad7 Antibody [NBP1-87728] - Staining of human Liver shows very weak cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Smad7 Antibody [NBP1-87728] - Staining of human lung shows nuclear positivity in pneumnocytes and macrophages.

Immunohistochemistry-Paraffin: Smad7 Antibody [NBP1-87728] - Staining of human Kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Smad7 Antibody [NBP1-87728] - Staining of human Rectum shows moderate nuclear and cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Smad7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Smad7 Antibody - BSA Free (NBP1-87728) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Smad7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMAD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Smad7 Protein (NBP1-87728PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Smad7 Antibody - BSA Free

• CRCS3
• FLJ16482
• hSMAD7
• MAD homolog 7
• MAD homolog 8
• MAD, mothers against decapentaplegic homolog 7 (Drosophila)
• MADH7
• MADH7mothers against decapentaplegic homolog 7
• MADH8
• Mothers against decapentaplegic homolog 8
• Mothers against decapentaplegic, drosophila, homolog of, 7
• Mothers against DPP homolog 7
• Mothers against DPP homolog 8
• SMAD 7
• SMAD family member 7MAD (mothers against decapentaplegic, Drosophila) homolog 7
• SMAD, mothers against DPP homolog 7 (Drosophila)
• SMAD, mothers against DPP homolog 7
• Smad7

Background

SMADs are members of the MAD-related family of molecules. MAD-related proteins are a family of intracellular proteins that are essential components in the signaling pathways of the serine/threonine kinase receptors of the transforming growth factor beta superfamily (1). SMADs can be divided into receptor-regulated SMADs (R-SMADs: SMAD1, SMAD2, SMAD5, SMAD8 and SMAD9), common-mediator SMAD (co-SMAD: SMAD4), and inhibitory SMADs (I-SMADs: SMAD6 and SMAD7). SMAD1, SMAD5, SMAD8 and SMAD9 have high degrees of homology and antibodies are available that recognize sequences common to all of them. SMAD8 and SMAD9 are typically used asalternate namesfor one another in the literature. Human SMAD1 is a 465 amino acid protein; GenBank Accession No. AAP36050.1. Human SMAD2 is a 467 amino acid protein; GenBank Accession No. AAC51918.1 Human SMAD3 is a 425 amino acid protein; GenBank Accession No. NP_005893.1 Human SMAD4 is a 552 amino acid protein GenBank Accession No. NP_005350.1. Human SMAD5 is a 465 amino acid protein; GenBank Accession No. AAC50791.1. Human SMAD6 is a 496 amino acid protein; GenBank Accession No. AAH12986.1 Human SMAD7 is a 426 amino acid protein; GenBank Accession No. AAB81354.1 Mouse SMAD8 is a 430 amino acid protein; GenBank Accession No. AAN85445.1 Human SMAD9 is a 430 amino acid protein; GenBank Accession No. NP_005896.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Smad7 Antibody (NBP1-87728)(1)

Publication using NBP1-87728

• Ke Y, Li BZ, Nguyen K et al. IL22RA2 is a Smad7 target mediating alleviation of dermatitis and psoriatic phenotypes in mice The Journal of investigative dermatology 2023-05-19 [PMID: 37211203] (Western Blot, Immunohistochemistry-Paraffin, Mouse)

Bioinformatics

• Gene Symbol: SMAD7