Smad7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Smad7 Antibody [NBP1-87728] - Staining of human cell line U-251 MG shows localization to nucleoplasm, nucleoli fibrillar center, cytosol & centrosome.
Immunohistochemistry-Paraffin: Smad7 Antibody [NBP1-87728] - Staining of human lung shows moderate nuclear positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Smad7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMAD7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Smad7 Protein (NBP1-87728PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Smad7 Antibody

  • CRCS3
  • FLJ16482
  • hSMAD7
  • MAD homolog 7
  • MAD homolog 8
  • MAD, mothers against decapentaplegic homolog 7 (Drosophila)
  • MADH7
  • MADH7mothers against decapentaplegic homolog 7
  • MADH8
  • Mothers against decapentaplegic homolog 8
  • Mothers against decapentaplegic, drosophila, homolog of, 7
  • Mothers against DPP homolog 7
  • Mothers against DPP homolog 8
  • SMAD 7
  • SMAD family member 7MAD (mothers against decapentaplegic, Drosophila) homolog 7
  • SMAD, mothers against DPP homolog 7 (Drosophila)
  • SMAD, mothers against DPP homolog 7
  • Smad7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
NBP2-45808
Species: Hu
Applications: IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Smad7 Antibody (NBP1-87728) (0)

There are no publications for Smad7 Antibody (NBP1-87728).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad7 Antibody (NBP1-87728) (0)

There are no reviews for Smad7 Antibody (NBP1-87728). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Smad7 Antibody (NBP1-87728) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Smad7 Products

Bioinformatics Tool for Smad7 Antibody (NBP1-87728)

Discover related pathways, diseases and genes to Smad7 Antibody (NBP1-87728). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad7 Antibody (NBP1-87728)

Discover more about diseases related to Smad7 Antibody (NBP1-87728).
 

Pathways for Smad7 Antibody (NBP1-87728)

View related products by pathway.

PTMs for Smad7 Antibody (NBP1-87728)

Learn more about PTMs related to Smad7 Antibody (NBP1-87728).

Blogs on Smad7

There are no specific blogs for Smad7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smad7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD7
Entrez