Smad4 Antibody

Immunofluorescence: Smad4 Antibody [NBP1-84992] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & centrosome.

ChIP-Exo-Seq composite graph for Anti-SMAD4 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Western Blot: Smad4 Antibody [NBP1-84992] - Western blot analysis in mouse cell line NIH-3T3.

Western Blot: Smad4 Antibody [NBP1-84992] - Western blot analysis in human cell line SCLC-21H.

Immunohistochemistry-Paraffin: Smad4 Antibody [NBP1-84992] - Staining in human endometrium and skeletal muscle tissues using NBP1-84992 antibody. Corresponding SMAD4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Smad4 Antibody [NBP1-84992] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Smad4 Antibody [NBP1-84992] - Staining of human placenta shows moderate to strong cytoplasmic and nuclear positivity in trophoblastic and decidual cells.

Immunohistochemistry-Paraffin: Smad4 Antibody [NBP1-84992] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Smad4 Antibody [NBP1-84992] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Smad4 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
• Predicted Species: Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMAD4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq 1-10ug per reaction
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1.0 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. The antibody solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Smad4 Antibody

• DPC4
• DPC4SMAD, mothers against DPP homolog 4 (Drosophila)
• hSMAD4
• JIP
• MAD homolog 4
• MADH4
• MADH4mothers against decapentaplegic homolog 4
• mothers against decapentaplegic homolog 4
• mothers against decapentaplegic, Drosophila, homolog of, 4
• SMAD 4
• SMAD family member 4MAD, mothers against decapentaplegic homolog 4 (Drosophila)
• SMAD, mothers against DPP homolog 4
• Smad4

Background

Smad proteins, the mammalian homologs of the Drosophila Mothers against dpp (Mad) have been implicated as downstream effectors of TGFbeta/BMP signaling. Smad1 (also designated Madr1 or JV4-1), Smad5 and mammalian Smad8 (also designated Smad9 or MadH6) are effectors of BMP2 and BMP4 function while Smad2 (also designated Madr2 or JV18-1) and Smad3 are involved in TGFbeta and activin-mediated growth modulation. Smad4 (also designated DPC4) has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/TGFbeta signaling by interfering with TGFbeta-mediated phosphorylation of other Smad family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMAD4
• Uniprot:
  • Q13485()