Smad3 Antibody (1T1Q9)

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] - Western blot analysis of various lysates, using Smad3 Rabbit mAb at 1:20000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunohistochemistry: Smad3 Antibody (1T1Q9) [Smad3] - Immunohistochemistry analysis of paraffin-embedded Human tonsil using [KO Validated] Smad3 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Smad3 Antibody (1T1Q9) [Smad3] - Immunohistochemistry analysis of paraffin-embedded Human testis using [KO Validated] Smad3 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] - Western blot analysis of lysates from Rat testis, using Smad3 Rabbit mAb at 1:20000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Western Blot: Smad3 Antibody (1T1Q9) [Smad3] - Western blot analysis of lysates from wild type(WT) and Smad3 Rabbit mAb knockout (KO) HCT116(KO) cells, using Smad3 Rabbit mAb at 1:20000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP, KO
• Clone: 1T1Q9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Smad3 Antibody (1T1Q9) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1). HHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SMAD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:100 - 1:500
  • Knockout Validated
  • Western Blot 1:2000 - 1:20000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Smad3 Antibody (1T1Q9)

• DKFZp586N0721
• DKFZp686J10186
• hMAD-3
• hSMAD3
• HsT17436
• JV15-2MGC60396
• MAD homolog 3
• mad protein homolog
• MAD, mothers against decapentaplegic homolog 3 (Drosophila)
• MAD, mothers against decapentaplegic homolog 3
• mad3
• MADH3mad homolog JV15-2
• mothers against decapentaplegic homolog 3
• Mothers against DPP homolog 3
• SMA- and MAD-related protein 3
• SMAD 3
• SMAD family member 3HSPC193
• SMAD, mothers against DPP homolog 3 (Drosophila)
• SMAD, mothers against DPP homolog 3
• Smad3

Background

The protein encoded by the Smad3 gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Smad3 Antibody (NBP3-15672). (Showing 1 - 1 of 1 FAQ).

1. I was wondering if you can recommend any primary polyclonal Smad3 antibody (reactivity: human) for gel supershifts?
   • We do provide a wide range of Smad3 antibodies, but unfortunately none of them have been tested for gel shift assay, so we can't guarantee they will work for an application never tested before.

Bioinformatics

• Gene Symbol: SMAD3