We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Smad1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Endotoxin, AP

Order Details

Recombinant Human Smad1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human Smad1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SMAD1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Smad1 GST (N-Term) Protein

  • BSP1
  • BSP-1
  • hSMAD1
  • JV4-1SMAD, mothers against DPP homolog 1 (Drosophila)
  • MAD homolog 1
  • MADH1JV41
  • MADR1MAD, mothers against decapentaplegic homolog 1 (Drosophila)
  • Mad-related protein 1
  • mothers against decapentaplegic homolog 1
  • Mothers against DPP homolog 1
  • SMAD family member 1SMAD 1
  • SMAD, mothers against DPP homolog 1
  • Smad1
  • TGF-beta signaling protein 1
  • transforming growth factor-beta signaling protein 1

Background

SMAD1 - SMAD, mothers against DPP homolog 1 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM
Species: Hu, Mu, Rt
Applications: BA
314-BP
Species: Hu
Applications: BA, BA
AF3797
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
AF2097
Species: Hu
Applications: ChIP, ICC, WB
NBP2-67394
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
355-BM
Species: Hu, Mu, Rt
Applications: BA
NBP1-77836
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF7215
Species: Hu, Mu
Applications: ICC, IHC
354-BP
Species: Hu
Applications: BA
NB100-56440
Species: Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
DPI00
Species: Hu
Applications: ELISA
AF3025
Species: Hu
Applications: ELISA, ICC, WB
7754-BH/CF
Species: Hu
Applications: BA
507-BP
Species: Hu
Applications: BA
MAB2029
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
6057-NG
Species: Hu
Applications: BA

Publications for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

There are no publications for Smad1 Partial Recombinant Protein (H00004086-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

There are no reviews for Smad1 Partial Recombinant Protein (H00004086-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smad1 Partial Recombinant Protein (H00004086-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Smad1 Products

Research Areas for Smad1 Partial Recombinant Protein (H00004086-Q01)

Find related products by research area.

Blogs on Smad1.

Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology
Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t...  Read full blog post.

Nanog is a Master Controller of ES cell Pluripotency
Nanog, a homeodomain (HD) transcription factor, plays a critical role in the maintenance of embryonic stem (ES) cell self-renewal. Transcription regulator involved in inner cell mass and ES cell proliferation and self-renewal. Imposes pluripotency on ...  Read full blog post.

Transforming Growth Factor beta Signaling in Stem Cells
Transforming growth factor beta (TGF beta) signaling along with its family members have been implicated in development and maintenance of various organs. Stem cells are important contributors to this process and are characterized by their ability to s...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Smad1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD1