Smad1 Antibody

Western Blot: Smad1 Antibody [H00004086-D01P] - Analysis of SMAD1 expression in transfected 293T cell line by SMAD1 polyclonal antibody.Lane 1: SMAD1 transfected lysate(52.30 KDa).Lane 2: Non-transfected lysate.

Proximity Ligation Assay: Smad1 Antibody [H00004086-D01P] - Analysis of protein-protein interactions between SMAD1 and GLI3. HeLa cells were stained with anti-SMAD1 rabbit purified polyclonal 1:1200 and anti-GLI3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Product Discontinued

Smad1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: SMAD1 (NP_001003688.1, 1 a.a. - 465 a.a.) full-length human protein. MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
• Specificity: SMAD1 - SMAD family member 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMAD1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smad1 Antibody

• BSP1
• BSP-1
• hSMAD1
• JV4-1SMAD, mothers against DPP homolog 1 (Drosophila)
• MAD homolog 1
• MADH1JV41
• MADR1MAD, mothers against decapentaplegic homolog 1 (Drosophila)
• Mad-related protein 1
• mothers against decapentaplegic homolog 1
• Mothers against DPP homolog 1
• SMAD family member 1SMAD 1
• SMAD, mothers against DPP homolog 1
• Smad1
• TGF-beta signaling protein 1
• transforming growth factor-beta signaling protein 1

Background

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMAD1
• Entrez:
  • 4086(Human)
• Uniprot:
  • NP_001003688.1(Human)