SMAD1/5/9 Antibody - Azide and BSA Free

Western Blot: SMAD1/5/9 Antibody [NBP3-05662] - Western blot analysis of extracts of C2C12 cells, using SMAD1/5/9 antibody (NBP3-05662) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

Product Discontinued

SMAD1/5/9 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 365-465 of human SMAD1/5/9 (NP_005891.1). FHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMAD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SMAD1/5/9 Antibody - Azide and BSA Free

• BSP1
• BSP-1
• hSMAD1
• JV4-1SMAD, mothers against DPP homolog 1 (Drosophila)
• MAD homolog 1
• MADH1JV41
• MADR1MAD, mothers against decapentaplegic homolog 1 (Drosophila)
• Mad-related protein 1
• mothers against decapentaplegic homolog 1
• Mothers against DPP homolog 1
• SMAD family member 1SMAD 1
• SMAD, mothers against DPP homolog 1
• Smad1
• TGF-beta signaling protein 1
• transforming growth factor-beta signaling protein 1

Background

Smad proteins, the mammalian homologs of the Drosophila Mothers against dpp (Mad) have been implicated as downstream effectors of TGFbeta/BMP signaling. Smad1 (also designated Madr1 or JV4-1), Smad5 and mammalian Smad8 (also designated Smad9 or MadH6) are effectors of BMP2 and BMP4 function while Smad2 (also designated Madr2 or JV18-1) and Smad3 are involved in TGFbeta and activin-mediated growth modulation. Smad4 (also designated DPC4) has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/TGFbeta signaling by interfering with TGFbeta-mediated phosphorylation of other Smad family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SMAD1