SMAC/Diablo Antibody

Images

 
Western Blot: SMAC/Diablo Antibody [NBP1-84262] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SMAC/Diablo Antibody [NBP1-84262] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: SMAC/Diablo Antibody [NBP1-84262] - Staining in human testis and skeletal muscle tissues using anti-DIABLO antibody. Corresponding DIABLO RNA-seq data are presented for the same tissues.
Western Blot: SMAC/Diablo Antibody [NBP1-84262] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
Immunohistochemistry-Paraffin: SMAC/Diablo Antibody [NBP1-84262] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: SMAC/Diablo Antibody [NBP1-84262] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMAC/Diablo Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG
Specificity
Specificity of human, rat SMAC/Diablo antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DIABLO
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMAC/Diablo Protein (NBP1-84262PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMAC/Diablo Antibody

  • 0610041G12Rik
  • Diablo
  • diablo, IAP-binding mitochondrial protein
  • Direct IAP-binding protein with low pI
  • mitochondrial Smac protein
  • Second mitochondria-derived activator of caspase
  • SMAC
  • SMACmitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
AF1458
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-31106
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, ICC
NB120-7325
Species: Bv
Applications: WB, ELISA, IHC, IHC-P
NBP1-06579
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-65092
Species: Hu
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-84262
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SMAC/Diablo Antibody (NBP1-84262) (0)

There are no publications for SMAC/Diablo Antibody (NBP1-84262).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMAC/Diablo Antibody (NBP1-84262) (0)

There are no reviews for SMAC/Diablo Antibody (NBP1-84262). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMAC/Diablo Antibody (NBP1-84262) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SMAC/Diablo Antibody (NBP1-84262)

Discover related pathways, diseases and genes to SMAC/Diablo Antibody (NBP1-84262). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMAC/Diablo Antibody (NBP1-84262)

Discover more about diseases related to SMAC/Diablo Antibody (NBP1-84262).
 

Pathways for SMAC/Diablo Antibody (NBP1-84262)

View related products by pathway.

PTMs for SMAC/Diablo Antibody (NBP1-84262)

Learn more about PTMs related to SMAC/Diablo Antibody (NBP1-84262).

Blogs on SMAC/Diablo.

Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMAC/Diablo Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DIABLO
Entrez