Slit3 Antibody

Images

 
Western Blot: Slit3 Antibody [NBP1-59140] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.
Western Blot: Slit3 Antibody [NBP1-59140] - Jurkat Cell lysates, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Slit3 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLIT3(slit homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of SLIT3 (NP_003053). Peptide sequence PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLIT3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLIT3 and was validated on Western blot.
Theoretical MW
168 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-59140 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Slit3 Antibody

  • KIAA0814
  • MEGF5
  • MEGF5Multiple epidermal growth factor-like domains protein 5
  • Multiple EGF-like domains protein 5
  • SLIL2
  • SLIL2FLJ10764
  • slit homolog 3 (Drosophila)
  • slit homolog 3 protein
  • SLIT1
  • slit2
  • Slit3
  • Slit-3slit (Drosophila) homolog 3

Background

SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1749
Species: Rt
Applications: IHC, WB
NBP1-81399
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
1109-N1/CF
Species: Mu
Applications: Bind
NB110-58780
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3076
Species: Hu
Applications: IHC, WB
AF844
Species: Mu
Applications: Block, WB
NBP2-27419
Species: Hu, Pm
Applications: IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-87076
Species: Hu
Applications: IHC, IHC-P, WB
5190-GR
Species: Hu
Applications: BA
AF1166
Species: Mu
Applications: WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DLP00
Species: Hu
Applications: ELISA
MAB1790
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
1250-S3
Species: Hu
Applications: BA, BA
236-EG
Species: Hu
Applications: BA

Publications for Slit3 Antibody (NBP1-59140)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Slit3 Antibody (NBP1-59140) (0)

There are no reviews for Slit3 Antibody (NBP1-59140). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Slit3 Antibody (NBP1-59140) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Slit3 Products

Bioinformatics Tool for Slit3 Antibody (NBP1-59140)

Discover related pathways, diseases and genes to Slit3 Antibody (NBP1-59140). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Slit3 Antibody (NBP1-59140)

Discover more about diseases related to Slit3 Antibody (NBP1-59140).
 

Pathways for Slit3 Antibody (NBP1-59140)

View related products by pathway.

PTMs for Slit3 Antibody (NBP1-59140)

Learn more about PTMs related to Slit3 Antibody (NBP1-59140).
 

Research Areas for Slit3 Antibody (NBP1-59140)

Find related products by research area.

Blogs on Slit3

There are no specific blogs for Slit3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Slit3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLIT3
Entrez
Uniprot