Slit3 Antibody - BSA Free

Western Blot: Slit3 Antibody [NBP1-59140] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Western Blot: Slit3 Antibody [NBP1-59140] - Jurkat Cell lysates, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Slit3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLIT3(slit homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of SLIT3 (NP_003053). Peptide sequence PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLIT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 168 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Slit3 Antibody - BSA Free

• KIAA0814
• MEGF5
• MEGF5Multiple epidermal growth factor-like domains protein 5
• Multiple EGF-like domains protein 5
• SLIL2
• SLIL2FLJ10764
• slit homolog 3 (Drosophila)
• slit homolog 3 protein
• SLIT1
• slit2
• Slit3
• Slit-3slit (Drosophila) homolog 3

Background

SLIT3 may act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Slit3 Antibody (NBP1-59140)(1)

Publication using NBP1-59140

• Ng L, Chow AKM, Man JHW et al. Suppression of Slit3 induces tumor proliferation and chemoresistance in hepatocellular carcinoma through activation of GSK3b/b-catenin pathway BMC Cancer. [PMID: 29859044] (WB, Human)

Bioinformatics

• Gene Symbol: SLIT3
• Entrez:
  • 6586(Human)
• Uniprot:
  • O75094()