GSTM2 Antibody (1E10.)

Images

 
Western Blot: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of GSTM2 expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: GSTM2 Antibody (1E10) [H00002946-M03] - Analysis of monoclonal antibody to GSTM2 on formalin-fixed paraffin-embedded human breast cancer. Antibody concentration 3 ug/ml
Sandwich ELISA: GSTM2 Antibody (1E10) [H00002946-M03] - Detection limit for recombinant GST tagged GSTM2 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GSTM2 Antibody (1E10.) Summary

Immunogen
GSTM2 (NP_000839, 90 a.a. - 189 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE
Specificity
GSTM2 - glutathione S-transferase M2 (muscle) (1E10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GSTM2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00002946-M03.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GSTM2 Antibody (1E10.)

  • glutathione S-transferase mu 2 (muscle)
  • MGC117303
  • muscle
  • S-(hydroxyalkyl)glutathione lyase M2

Background

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GSTM2 Antibody (H00002946-M03)(1)

Reviews for GSTM2 Antibody (H00002946-M03) (0)

There are no reviews for GSTM2 Antibody (H00002946-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSTM2 Antibody (H00002946-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GSTM2 Products

Bioinformatics Tool for GSTM2 Antibody (H00002946-M03)

Discover related pathways, diseases and genes to GSTM2 Antibody (H00002946-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSTM2 Antibody (H00002946-M03)

Discover more about diseases related to GSTM2 Antibody (H00002946-M03).
 

Pathways for GSTM2 Antibody (H00002946-M03)

View related products by pathway.

PTMs for GSTM2 Antibody (H00002946-M03)

Learn more about PTMs related to GSTM2 Antibody (H00002946-M03).

Blogs on GSTM2

There are no specific blogs for GSTM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSTM2 Antibody (1E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol GSTM2
Entrez
Uniprot