SLCO1A2 Antibody

Images

 
Western Blot: SLCO1A2 Antibody [NBP2-56965] - Analysis in human cell line NTERA-2.
Immunocytochemistry/ Immunofluorescence: SLCO1A2 Antibody [NBP2-56965] - Staining of human cell line SH-SY5Y shows localization to plasma membrane. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLCO1A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN
Specificity
Specificity of human SLCO1A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLCO1A2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLCO1A2 Recombinant Protein Antigen (NBP2-56965PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SLCO1A2 Antibody

  • OATP1
  • OATP1A2member 3
  • OATP-AOATP-1
  • OATPSolute carrier family 21 member 3
  • Organic anion-transporting polypeptide 1
  • Sodium-independent organic anion transporter
  • solute carrier organic anion transporter family member 1A2
  • solute carrier organic anion transporter family, member 1A2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-80870
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ELISA, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP1-60109
Species: Hu
Applications: WB
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-51684
Species: Hu, Mu
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80977
Species: Hu
Applications: IHC, IHC-P

Publications for SLCO1A2 Antibody (NBP2-56965) (0)

There are no publications for SLCO1A2 Antibody (NBP2-56965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLCO1A2 Antibody (NBP2-56965) (0)

There are no reviews for SLCO1A2 Antibody (NBP2-56965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLCO1A2 Antibody (NBP2-56965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLCO1A2 Products

Bioinformatics Tool for SLCO1A2 Antibody (NBP2-56965)

Discover related pathways, diseases and genes to SLCO1A2 Antibody (NBP2-56965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLCO1A2 Antibody (NBP2-56965)

Discover more about diseases related to SLCO1A2 Antibody (NBP2-56965).
 

Pathways for SLCO1A2 Antibody (NBP2-56965)

View related products by pathway.

PTMs for SLCO1A2 Antibody (NBP2-56965)

Learn more about PTMs related to SLCO1A2 Antibody (NBP2-56965).

Blogs on SLCO1A2

There are no specific blogs for SLCO1A2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLCO1A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO1A2