SLC6A15 Antibody - BSA Free

Western Blot: SLC6A15 Antibody [NBP2-93531] - Analysis of extracts of mouse kidney, using SLC6A15 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC6A15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC6A15 Antibody - BSA Free (NBP2-93531) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human SLC6A15 (NP_877499.1). LVVFAVLGFKANVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPALHLNSCKIEEELNKAVQGTGLAFIAFTEAM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC6A15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC6A15 Antibody - BSA Free

• B0AT2
• DKFZp761I0921
• FLJ10316
• homolog of rat orphan transporter v7-3
• hv7-3
• MGC87066
• NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73
• orphan transporter v7-3
• SBAT1
• Sodium- and chloride-dependent neurotransmitter transporter NTT73
• sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7
• Sodium-coupled branched-chain amino-acid transporter 1
• solute carrier family 6 (neurotransmitter transporter), member 15
• solute carrier family 6 (neutral amino acid transporter), member 15
• Solute carrier family 6 member 15
• solute carrier family 6, member 15
• Transporter v7-3
• V7-3

Background

SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites (Farmer et al., 2000 [PubMed 11112352]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A15