SLC6A16 Antibody (2E5) - Azide and BSA Free

Western Blot: SLC6A16 Antibody (2E5) [H00028968-M13] - Analysis of SLC6A16 expression in transfected 293T cell line by SLC6A16 monoclonal antibody (M13), clone 2E5. Lane 1: SLC6A16 transfected lysate (Predicted MW: 73.5 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: SLC6A16 Antibody (2E5) [H00028968-M13] - Analysis of monoclonal antibody to SLC6A16 on HeLa cell. Antibody concentration 10 ug/ml

Sandwich ELISA: SLC6A16 Antibody (2E5) [H00028968-M13] - Detection limit for recombinant GST tagged SLC6A16 is 1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 2E5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SLC6A16 Antibody (2E5) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SLC6A16 Antibody (2E5) - Azide and BSA Free (H00028968-M13) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SLC6A16 (NP_054756.2, 406 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP
• Specificity: SLC6A16 - solute carrier family 6, member 16 (2E5)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC6A16
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SLC6A16 Antibody (2E5) - Azide and BSA Free

• NTT5solute carrier family 6 (neurotransmitter transporter), member 16
• orphan sodium- and chloride-dependent neurotransmitter transporter NTT5
• Solute carrier family 6 member 16
• solute carrier family 6, member 16

Background

SLC6A16 shows structural characteristics of an Na(+)- and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A16
• Entrez:
  • 28968(Human)
• Uniprot:
  • NP_054756(Human)