EYA4 Antibody

Images

 
Western Blot: EYA4 Antibody [NBP1-85546] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: EYA4 Antibody [NBP1-85546] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EYA4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EYA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EYA4 Protein (NBP1-85546PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EYA4 Antibody

  • CMD1J
  • DFNA10
  • dJ78N10.1 (eyes absent)
  • EC 3.1.3.48
  • eyes absent (Drosophila) homolog 4
  • eyes absent homolog 4 (Drosophila)
  • eyes absent homolog 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58069
Species: Hu
Applications: ICC/IF
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88637
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-84026
Species: Hu
Applications: WB, IHC, IHC-P
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88349
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83530
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24737
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-32440
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
AF2746
Species: Hu, Mu
Applications: WB, ICC
NB600-230
Species: Hu
Applications: WB

Publications for EYA4 Antibody (NBP1-85546) (0)

There are no publications for EYA4 Antibody (NBP1-85546).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EYA4 Antibody (NBP1-85546) (0)

There are no reviews for EYA4 Antibody (NBP1-85546). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EYA4 Antibody (NBP1-85546) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EYA4 Products

Bioinformatics Tool for EYA4 Antibody (NBP1-85546)

Discover related pathways, diseases and genes to EYA4 Antibody (NBP1-85546). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EYA4 Antibody (NBP1-85546)

Discover more about diseases related to EYA4 Antibody (NBP1-85546).
 

Pathways for EYA4 Antibody (NBP1-85546)

View related products by pathway.

PTMs for EYA4 Antibody (NBP1-85546)

Learn more about PTMs related to EYA4 Antibody (NBP1-85546).
 

Research Areas for EYA4 Antibody (NBP1-85546)

Find related products by research area.

Blogs on EYA4

There are no specific blogs for EYA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EYA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EYA4