SLC6A15 Antibody


Immunocytochemistry/ Immunofluorescence: SLC6A15 Antibody [NBP1-83867] - Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoli & vesicles.
Immunohistochemistry-Paraffin: SLC6A15 Antibody [NBP1-83867] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SLC6A15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RELDDDVTESVKDLLSNEDAADDAFKTSELIVDGQEEKDTDVEEGSEVEDERPAWNSKLQ
Specificity of human SLC6A15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC6A15 Protein (NBP1-83867PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC6A15 Antibody

  • B0AT2
  • DKFZp761I0921
  • FLJ10316
  • homolog of rat orphan transporter v7-3
  • hv7-3
  • MGC87066
  • NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73
  • orphan transporter v7-3
  • SBAT1
  • Sodium- and chloride-dependent neurotransmitter transporter NTT73
  • sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7
  • Sodium-coupled branched-chain amino-acid transporter 1
  • solute carrier family 6 (neurotransmitter transporter), member 15
  • solute carrier family 6 (neutral amino acid transporter), member 15
  • Solute carrier family 6 member 15
  • solute carrier family 6, member 15
  • Transporter v7-3
  • V7-3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
Species: Hu
Species: Hu
Applications: WB, TCS
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC6A15 Antibody (NBP1-83867) (0)

There are no publications for SLC6A15 Antibody (NBP1-83867).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A15 Antibody (NBP1-83867) (0)

There are no reviews for SLC6A15 Antibody (NBP1-83867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC6A15 Antibody (NBP1-83867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC6A15 Products

Bioinformatics Tool for SLC6A15 Antibody (NBP1-83867)

Discover related pathways, diseases and genes to SLC6A15 Antibody (NBP1-83867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A15 Antibody (NBP1-83867)

Discover more about diseases related to SLC6A15 Antibody (NBP1-83867).

Pathways for SLC6A15 Antibody (NBP1-83867)

View related products by pathway.

PTMs for SLC6A15 Antibody (NBP1-83867)

Learn more about PTMs related to SLC6A15 Antibody (NBP1-83867).

Blogs on SLC6A15

There are no specific blogs for SLC6A15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC6A15 Antibody and receive a gift card or discount.


Gene Symbol SLC6A15