SLC6A15 Antibody

Images

 
Western Blot: SLC6A15 Antibody [NBP1-74198] - Mouse Kidney Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC6A15 Antibody Summary

Immunogen
Synthetic peptides corresponding to the middle region of Slc6a15. Immunizing peptide sequence VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Slc6a15 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC6A15 Antibody

  • B0AT2
  • DKFZp761I0921
  • FLJ10316
  • homolog of rat orphan transporter v7-3
  • hv7-3
  • MGC87066
  • NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73
  • orphan transporter v7-3
  • SBAT1
  • Sodium- and chloride-dependent neurotransmitter transporter NTT73
  • sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7
  • Sodium-coupled branched-chain amino-acid transporter 1
  • solute carrier family 6 (neurotransmitter transporter), member 15
  • solute carrier family 6 (neutral amino acid transporter), member 15
  • Solute carrier family 6 member 15
  • solute carrier family 6, member 15
  • Transporter v7-3
  • V7-3

Background

Slc6a15 functions as a sodium-dependent neutral amino acid transporter. It exhibits preference for methionine and for the branched-chain amino acids, particulary leucine, valine and isoleucine. It mediates the saturable, pH-sensitive and electrogenic cotransport of proline and sodium ions with a stoichiometry of 1:1. Slc6a15 may have a role as transporter for neurotransmitter precursors into neurons. In contrast to other members of the neurotransmitter transporter family, Slc6a15 does not appear to be chloride-dependent.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77368
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-86277
Species: Hu
Applications: IHC, IHC-P
NBP1-59882
Species: Hu
Applications: WB, IHC
NB100-56092
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77078
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86494
Species: Hu
Applications: IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
H00028968-M13
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-26618
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-06677
Species: Hu
NBP1-60120
Species: Hu
Applications: WB, TCS
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00001848-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-85548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85040
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74198
Species: Mu
Applications: WB

Publications for SLC6A15 Antibody (NBP1-74198) (0)

There are no publications for SLC6A15 Antibody (NBP1-74198).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC6A15 Antibody (NBP1-74198) (0)

There are no reviews for SLC6A15 Antibody (NBP1-74198). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC6A15 Antibody (NBP1-74198) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC6A15 Products

Bioinformatics Tool for SLC6A15 Antibody (NBP1-74198)

Discover related pathways, diseases and genes to SLC6A15 Antibody (NBP1-74198). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC6A15 Antibody (NBP1-74198)

Discover more about diseases related to SLC6A15 Antibody (NBP1-74198).
 

Pathways for SLC6A15 Antibody (NBP1-74198)

View related products by pathway.

PTMs for SLC6A15 Antibody (NBP1-74198)

Learn more about PTMs related to SLC6A15 Antibody (NBP1-74198).

Blogs on SLC6A15

There are no specific blogs for SLC6A15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC6A15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A15
Uniprot