SLC6A15 Antibody - BSA Free

Western Blot: SLC6A15 Antibody [NBP1-59366] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SLC6A15 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SLC6A15(solute carrier family 6, member 15) The peptide sequence was selected from the N terminal of SLC6A15. Peptide sequence DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC6A15
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SLC6A15 Antibody - BSA Free

• B0AT2
• DKFZp761I0921
• FLJ10316
• homolog of rat orphan transporter v7-3
• hv7-3
• MGC87066
• NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73
• orphan transporter v7-3
• SBAT1
• Sodium- and chloride-dependent neurotransmitter transporter NTT73
• sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7
• Sodium-coupled branched-chain amino-acid transporter 1
• solute carrier family 6 (neurotransmitter transporter), member 15
• solute carrier family 6 (neutral amino acid transporter), member 15
• Solute carrier family 6 member 15
• solute carrier family 6, member 15
• Transporter v7-3
• V7-3

Background

SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites.SLC6A15 shows structural characteristics of an Na(+) and Cl(-)-dependent neurotransmitter transporter, including 12 transmembrane (TM) domains, intracellular N and C termini, and large extracellular loops containing multiple N-glycosylation sites (Farmer et al., 2000 [PubMed 11112352]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-438 BC070040.1 1-438 439-440 BC022253.1 437-438 441-1217 BC022253.1 440-1216 1218-3608 BC070040.1 1216-3606 3609-3809 BM696062.1 233-433 3810-4573 AF351619.1 2384-3147 4574-4807 AI368909.1 1-234 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A15
• Uniprot:
  • Q9H2J7(Human)