SLC43A2 Antibody

Images

 
Western Blot: SLC43A2 Antibody [NBP1-82706] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: SLC43A2 Antibody [NBP1-82706] - Staining in human placenta and liver tissues using anti-SLC43A2 antibody. Corresponding SLC43A2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SLC43A2 Antibody [NBP1-82706] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: SLC43A2 Antibody [NBP1-82706] - Staining of human placenta shows high expression.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC43A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YRRQLERQLQQRQEDDKLFLKINGSSNQEAFV
Specificity
Specificity of human SLC43A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC43A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC43A2 Protein (NBP1-82706PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC43A2 Antibody

  • FLJ23848
  • large neutral amino acids transporter small subunit 4
  • LAT4amino acid transporter
  • L-type amino acid transporter 4
  • MGC34680
  • Solute carrier family 43 member 2
  • solute carrier family 43, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-64989
Species: Hu
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00289
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-82826
Species: Hu
Applications: IHC, IHC-P
NBP1-87332
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80700
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47515
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-65321
Species: Hu
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-55228
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-64666
Species: Hu
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87850
Species: Hu
Applications: IHC, IHC-P
H00009498-M04
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-21399
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP
NBP1-82706
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for SLC43A2 Antibody (NBP1-82706) (0)

There are no publications for SLC43A2 Antibody (NBP1-82706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC43A2 Antibody (NBP1-82706) (0)

There are no reviews for SLC43A2 Antibody (NBP1-82706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC43A2 Antibody (NBP1-82706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC43A2 Products

Bioinformatics Tool for SLC43A2 Antibody (NBP1-82706)

Discover related pathways, diseases and genes to SLC43A2 Antibody (NBP1-82706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC43A2 Antibody (NBP1-82706)

Discover more about diseases related to SLC43A2 Antibody (NBP1-82706).
 

Pathways for SLC43A2 Antibody (NBP1-82706)

View related products by pathway.

Blogs on SLC43A2

There are no specific blogs for SLC43A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC43A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC43A2
Entrez
Uniprot