SLC7A7 Antibody - BSA Free

Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining in human kidney and prostate tissues using anti-SLC7A7 antibody. Corresponding SLC7A7 RNA-seq data are presented for the same tissues.

Western Blot: SLC7A7 Antibody [NBP1-82826] - Analysis in control (vector only transfected HEK293T lysate) and SLC7A7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human prostate shows low expression as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC7A7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC7A7 Antibody - BSA Free (NBP1-82826) is a polyclonal antibody validated for use in IHC and WB. Anti-SLC7A7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC7A7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SLC7A7 Protein (NBP1-82826PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC7A7 Antibody - BSA Free

• LAT3
• LPI
• Monocyte amino acid permease 2
• MOP-2
• SLC7A7
• solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
• Solute carrier family 7 member 7
• Y+L amino acid transporter 1
• Y+LAT1
• y+LAT-1y(+)L-type amino acid transporter 1

Background

SLC7A7 is encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC7A7 Antibody (NBP1-82826)(1)

Publication using NBP1-82826

• Christopher Chidley, Alicia M. Darnell, Benjamin L. Gaudio, Evan C. Lien, Anna M. Barbeau, Matthew G. Vander Heiden, Peter K. Sorger A CRISPRi/a screening platform to study cellular nutrient transport in diverse microenvironments Nature Cell Biology 2024-04-11 [PMID: 38605144]

Bioinformatics

• Gene Symbol: SLC7A7