SLC7A7 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC7A7 Antibody [NBP1-82826] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC7A7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DSTEYEVASQPEVETSPLGDGASPGPEQVKLKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC7A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC7A7 Protein (NBP1-82826PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC7A7 Antibody

  • LAT3
  • LPI
  • Monocyte amino acid permease 2
  • MOP-2
  • SLC7A7
  • solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
  • Solute carrier family 7 member 7
  • Y+L amino acid transporter 1
  • Y+LAT1
  • y+LAT-1y(+)L-type amino acid transporter 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36491
Species: Hu
Applications: WB, Flow, IHC, IHC-P, Flow-CS
NBP2-30868
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NLS164
Species: Hu
Applications: IHC, IHC-P
NBP1-90066
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P
2984-SE
Species: Hu
NBP2-24716
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-58924
Species: Hu
Applications: ICC/IF
MAB4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92409
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
NLS32
Species: Hu, Mu, Rt, Po, Bt, Bv, Ca, Eq, Mk, Pm
Applications: ICC/IF, IHC-P, ICC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for SLC7A7 Antibody (NBP1-82826) (0)

There are no publications for SLC7A7 Antibody (NBP1-82826).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC7A7 Antibody (NBP1-82826) (0)

There are no reviews for SLC7A7 Antibody (NBP1-82826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC7A7 Antibody (NBP1-82826) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC7A7 Products

Bioinformatics Tool for SLC7A7 Antibody (NBP1-82826)

Discover related pathways, diseases and genes to SLC7A7 Antibody (NBP1-82826). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC7A7 Antibody (NBP1-82826)

Discover more about diseases related to SLC7A7 Antibody (NBP1-82826).
 

Pathways for SLC7A7 Antibody (NBP1-82826)

View related products by pathway.

PTMs for SLC7A7 Antibody (NBP1-82826)

Learn more about PTMs related to SLC7A7 Antibody (NBP1-82826).

Blogs on SLC7A7

There are no specific blogs for SLC7A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC7A7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC7A7
Entrez