SLC28A2 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human small intestine.
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining in human duodenum and liver tissues using anti-SLC28A2 antibody. Corresponding SLC28A2 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human colon, liver, lymph node and small intestine using Anti-SLC28A2 antibody NBP2-38763 (A) shows similar ...read more
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC28A2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC28A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC28A2 Protein (NBP2-38763PEP)
Publications
Read Publication using
NBP2-38763 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC28A2 Antibody

  • CNT2SPNT
  • Concentrative nucleoside transporter 2
  • FLJ21468
  • HCNT2
  • HsT17153
  • MGC138252
  • Na(+)/nucleoside cotransporter 2
  • sodium/nucleoside cotransporter 2
  • Sodium/purine nucleoside co-transporter
  • Sodium-coupled nucleoside transporter 2
  • solute carrier family 28 (sodium-coupled nucleoside transporter), member 2
  • Solute carrier family 28 member 2
  • SPNT1CNT 2

Background

Sodium-dependent and purine-selective transporter. Exhibits the transport characteristics of the nucleoside transport system cif or N1 subtype (N1/cif) (selective for purine nucleosides and uridine). Plays a critical role in specific uptake and salvage of purine nucleosides in kidney and other tissues

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC28A2 Antibody (NBP2-38763)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SLC28A2 Antibody (NBP2-38763) (0)

There are no reviews for SLC28A2 Antibody (NBP2-38763). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC28A2 Antibody (NBP2-38763) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC28A2 Products

Research Areas for SLC28A2 Antibody (NBP2-38763)

Find related products by research area.

Blogs on SLC28A2

There are no specific blogs for SLC28A2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC28A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC28A2
Uniprot