SLC28A2 Antibody


Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human small intestine.
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining in human duodenum and liver tissues using anti-SLC28A2 antibody. Corresponding SLC28A2 RNA-seq data are presented for more
Independent Antibodies: Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human colon, liver, lymph node and small intestine using Anti-SLC28A2 antibody NBP2-38763 (A) shows similar more
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human lymph node.
Immunohistochemistry-Paraffin: SLC28A2 Antibody [NBP2-38763] - Staining of human colon.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

SLC28A2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC28A2 Protein (NBP2-38763PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC28A2 Antibody

  • Concentrative nucleoside transporter 2
  • FLJ21468
  • HCNT2
  • HsT17153
  • MGC138252
  • Na(+)/nucleoside cotransporter 2
  • sodium/nucleoside cotransporter 2
  • Sodium/purine nucleoside co-transporter
  • Sodium-coupled nucleoside transporter 2
  • solute carrier family 28 (sodium-coupled nucleoside transporter), member 2
  • Solute carrier family 28 member 2
  • SPNT1CNT 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, Flow-IC, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P

Publications for SLC28A2 Antibody (NBP2-38763) (0)

There are no publications for SLC28A2 Antibody (NBP2-38763).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC28A2 Antibody (NBP2-38763) (0)

There are no reviews for SLC28A2 Antibody (NBP2-38763). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC28A2 Antibody (NBP2-38763) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SLC28A2 Products

Bioinformatics Tool for SLC28A2 Antibody (NBP2-38763)

Discover related pathways, diseases and genes to SLC28A2 Antibody (NBP2-38763). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC28A2 Antibody (NBP2-38763)

Discover more about diseases related to SLC28A2 Antibody (NBP2-38763).

Pathways for SLC28A2 Antibody (NBP2-38763)

View related products by pathway.

PTMs for SLC28A2 Antibody (NBP2-38763)

Learn more about PTMs related to SLC28A2 Antibody (NBP2-38763).

Blogs on SLC28A2

There are no specific blogs for SLC28A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC28A2 Antibody and receive a gift card or discount.


Gene Symbol SLC28A2