SLC28A3 Antibody

Images

 
Western Blot: SLC28A3 Antibody [NBP1-84418] - Analysis in control (vector only transfected HEK293T lysate) and SLC28A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: SLC28A3 Antibody [NBP1-84418] - Staining of human pancreas cryosection (100x). Ducts and acinar cells (but not islets) are strongly labeled. Image from verified customer review.
Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84418] - Staining of human pancreas shows strong cytoplasmic positivity in intercalated duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC28A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:INCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC28A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC28A3 Protein (NBP1-84418PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-84418 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC28A3 Antibody

  • CNT 3
  • CNT3concentrative Na+-nucleoside cotransporter
  • Concentrative Na(+)-nucleoside cotransporter 3
  • hCNT3
  • solute carrier family 28 (sodium-coupled nucleoside transporter), member 3
  • solute carrier family 28 member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33451
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-30857
Species: Hu
Applications: IHC, IHC-P
NBP1-50508
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-69313
Species: Hu
Applications: WB
NBP2-31589
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
AF1235
Species: Hu
Applications: WB, IHC
NBP2-41314
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP2-46466
Species: Hu
Applications: IHC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57222
Species: Hu
Applications: ICC/IF
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt

Publications for SLC28A3 Antibody (NBP1-84418) (0)

There are no publications for SLC28A3 Antibody (NBP1-84418).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SLC28A3 Antibody (NBP1-84418) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 application: IF.

Reviews using NBP1-84418:
Filter by Applications
IF
(1)
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunofluorescence SLC28A3 NBP1-84418
Enlarge
reviewed by:
Anonymous
IF 05/09/2014
View

Summary

ApplicationImmunofluorescence
LotR11669

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC28A3 Antibody (NBP1-84418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
05/09/2014
Application: IF
Species:

Bioinformatics

Gene Symbol SLC28A3
Entrez
Uniprot