SLC28A3 Antibody


Western Blot: SLC28A3 Antibody [NBP1-84418] - Analysis in control (vector only transfected HEK293T lysate) and SLC28A3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry: SLC28A3 Antibody [NBP1-84418] - Staining of human pancreas cryosection (100x). Ducts and acinar cells (but not islets) are strongly labeled. Image from verified customer review.
Immunohistochemistry-Paraffin: SLC28A3 Antibody [NBP1-84418] - Staining of human pancreas shows strong cytoplasmic positivity in intercalated duct cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

SLC28A3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: INCHHVLENAFNSTFPGNTTKVIACCQSLLSSTVAKGPGEVIPGGNHSLYSLKGCCTLLNPSTFNCNGISNT
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC28A3 Protein (NBP1-84418PEP)
Reviewed Applications
Read 1 Review rated 5
NBP1-84418 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC28A3 Antibody

  • CNT 3
  • CNT3concentrative Na+-nucleoside cotransporter
  • Concentrative Na(+)-nucleoside cotransporter 3
  • hCNT3
  • solute carrier family 28 (sodium-coupled nucleoside transporter), member 3
  • solute carrier family 28 member 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, Flow-IC, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLC28A3 Antibody (NBP1-84418) (0)

There are no publications for SLC28A3 Antibody (NBP1-84418).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for SLC28A3 Antibody (NBP1-84418) (1) 51

Average Rating: 5
(Based on 1 review)

Reviews using NBP1-84418:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunofluorescence SLC28A3 NBP1-84418
reviewed by:
Verified Customer
IF 05/09/2014



Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC28A3 Antibody (NBP1-84418) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Verified Customer
Application: IF


Gene Symbol SLC28A3