ENT2 Antibody


Western Blot: ENT2 Antibody [NBP1-69313] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: ENT2 Antibody [NBP1-69313] - This Anti-SLC29A2 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.
Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: ENT2 Antibody [NBP1-69313] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ENT2 Antibody Summary

Synthetic peptides corresponding to SLC29A2(solute carrier family 29 (nucleoside transporters), member 2) The peptide sequence was selected from the C terminal of SLC29A2. Peptide sequence PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC29A2 and was validated on Western blot.
Theoretical MW
50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ENT2 Antibody

  • Delayed-early response protein 12
  • DER12
  • DER12Solute carrier family 29 member 2
  • ENT2
  • Equilibrative NBMPR-insensitive nucleoside transporter
  • Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleosidetransporter
  • equilibrative nucleoside transporter 2
  • HNP36
  • HNP3636 kDa nucleolar protein HNP36
  • Hydrophobic nucleolar protein, 36 kDa
  • hydrophobic nucleolar protein, 36kD
  • Nucleoside transporter, ei-type
  • SLC29A2
  • solute carrier family 29 (nucleoside transporters), member 2


SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB

Publications for ENT2 Antibody (NBP1-69313) (0)

There are no publications for ENT2 Antibody (NBP1-69313).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENT2 Antibody (NBP1-69313) (0)

There are no reviews for ENT2 Antibody (NBP1-69313). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ENT2 Antibody (NBP1-69313) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ENT2 Products

Bioinformatics Tool for ENT2 Antibody (NBP1-69313)

Discover related pathways, diseases and genes to ENT2 Antibody (NBP1-69313). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ENT2 Antibody (NBP1-69313)

Discover more about diseases related to ENT2 Antibody (NBP1-69313).

Pathways for ENT2 Antibody (NBP1-69313)

View related products by pathway.

PTMs for ENT2 Antibody (NBP1-69313)

Learn more about PTMs related to ENT2 Antibody (NBP1-69313).

Research Areas for ENT2 Antibody (NBP1-69313)

Find related products by research area.

Blogs on ENT2

There are no specific blogs for ENT2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ENT2 Antibody and receive a gift card or discount.


Gene Symbol SLC29A2