SLC25A32 Antibody


Western Blot: SLC25A32 Antibody [NBP1-59566] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SLC25A32 Antibody Summary

Synthetic peptides corresponding to SLC25A32(solute carrier family 25, member 32) The peptide sequence was selected from the middle region of SLC25A32 (NP_110407). Peptide sequence NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC25A32 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Read Publication using NBP1-59566.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC25A32 Antibody

  • mitochondrial folate transporter/carrier
  • Solute carrier family 25 member 32
  • solute carrier family 25, member 32


SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria (Titus and Moran, 2000 [PubMed 10978331]).[supplied by OMIM].


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, IP
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, ICC
Species: Hu, Rt
Applications: WB, ELISA, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Rt
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC

Publications for SLC25A32 Antibody (NBP1-59566)(1)

Showing Publication 1 - 1 of 1.
Publication using NBP1-59566 Applications Species
Titus,SA. J. Biol. Chem. 275 (47), 36811-36817. 2000 [PMID: 10978331]

Reviews for SLC25A32 Antibody (NBP1-59566) (0)

There are no reviews for SLC25A32 Antibody (NBP1-59566). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A32 Antibody (NBP1-59566) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC25A32 Products

Bioinformatics Tool for SLC25A32 Antibody (NBP1-59566)

Discover related pathways, diseases and genes to SLC25A32 Antibody (NBP1-59566). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A32 Antibody (NBP1-59566)

Discover more about diseases related to SLC25A32 Antibody (NBP1-59566).

Pathways for SLC25A32 Antibody (NBP1-59566)

View related products by pathway.

Blogs on SLC25A32

There are no specific blogs for SLC25A32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC25A32 Antibody and receive a gift card or discount.


Gene Symbol SLC25A32