SLC25A32 Antibody

Images

 
Western Blot: SLC25A32 Antibody [NBP1-59566] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC25A32 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC25A32(solute carrier family 25, member 32) The peptide sequence was selected from the middle region of SLC25A32 (NP_110407). Peptide sequence NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMFYSGVID.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC25A32
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against SLC25A32 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
SLC25A32 Lysate (NBP2-65676)
Publications
Read Publication using NBP1-59566.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC25A32 Antibody

  • MFTCMFTFLJ23872
  • mitochondrial folate transporter/carrier
  • Solute carrier family 25 member 32
  • solute carrier family 25, member 32

Background

SLC25A32 transports folate across the inner membranes of mitochondria. Folate metabolism is distributed between the cytosolic and mitochondrial compartments. SLC25A32 is a transporter that shuttles folates from the cytoplasm into mitochondria (Titus and Moran, 2000 [PubMed 10978331]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56461
Species: Hu
Applications: WB, Simple Western, ICC/IF
NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28457
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP, ICC
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
MAB4546
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow

Publications for SLC25A32 Antibody (NBP1-59566)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-59566 Applications Species
Titus,SA. J. Biol. Chem. 275 (47), 36811-36817. 2000 [PMID: 10978331]

Reviews for SLC25A32 Antibody (NBP1-59566) (0)

There are no reviews for SLC25A32 Antibody (NBP1-59566). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC25A32 Antibody (NBP1-59566) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC25A32 Antibody (NBP1-59566)

Discover related pathways, diseases and genes to SLC25A32 Antibody (NBP1-59566). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC25A32 Antibody (NBP1-59566)

Discover more about diseases related to SLC25A32 Antibody (NBP1-59566).
 

Pathways for SLC25A32 Antibody (NBP1-59566)

View related products by pathway.

Blogs on SLC25A32

There are no specific blogs for SLC25A32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC25A32 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC25A32
Entrez
Uniprot