SLC1A5 Antibody - BSA Free

Western Blot: SLC1A5 Antibody [NBP1-89328] - Analysis in control (vector only transfected HEK293T lysate) and SLC1A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: SLC1A5 Antibody [NBP1-89328] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89328] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Western Blot: SLC1A5 Antibody [NBP1-89328] - Analysis in human cell line A-549.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC1A5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SLC1A5 Antibody - BSA Free (NBP1-89328) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC1A5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SLC1A5 Recombinant Protein Antigen (NBP1-89328PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SLC1A5 Antibody - BSA Free

• AAAT
• Alanine/serine/cysteine transporter 2
• ASC amino acid transporter-2
• ASCT2
• ATB(0)
• ATBO
• baboon M7 virus receptor
• M7V1
• M7VS1
• neutral amino acid transporter B
• neutral amino acid transporter B(0)
• R16
• RD114 virus receptor
• RD114/simian type D retrovirus receptor
• RDR
• RDRC
• SLC1A5
• Sodium-dependent neutral amino acid transporter type 2
• solute carrier family 1 (neutral amino acid transporter), member 5
• Solute carrier family 1 member 5

Background

SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC1A5