SLC1A5 Antibody


Western Blot: SLC1A5 Antibody [NBP1-89328] - Analysis in human cell line A-549.
Immunocytochemistry/ Immunofluorescence: SLC1A5 Antibody [NBP1-89328] - Staining of human cell line A-431 shows localization to plasma membrane.
Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89328] - Staining of human epididymis shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SLC1A5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC1A5 Protein (NBP1-89328PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC1A5 Antibody

  • AAAT
  • ASCT2M7VS1
  • ATB(0)
  • Baboon M7 virus receptor
  • M7V1ATBO
  • neutral amino acid transporter B
  • neutral amino acid transporter B(0)
  • R16
  • RD114 virus receptor
  • RD114/simian type D retrovirus receptor
  • RDR
  • RDRCFLJ31068
  • Sodium-dependent neutral amino acid transporter type 2
  • solute carrier family 1 (neutral amino acid transporter), member 5
  • Solute carrier family 1 member 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC-P
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Pm
Applications: WB, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, B/N, IHC-Fr, IHC-P, In vitro

Publications for SLC1A5 Antibody (NBP1-89328) (0)

There are no publications for SLC1A5 Antibody (NBP1-89328).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC1A5 Antibody (NBP1-89328) (0)

There are no reviews for SLC1A5 Antibody (NBP1-89328). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SLC1A5 Antibody (NBP1-89328) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC1A5 Products

Bioinformatics Tool for SLC1A5 Antibody (NBP1-89328)

Discover related pathways, diseases and genes to SLC1A5 Antibody (NBP1-89328). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC1A5 Antibody (NBP1-89328)

Discover more about diseases related to SLC1A5 Antibody (NBP1-89328).

Pathways for SLC1A5 Antibody (NBP1-89328)

View related products by pathway.

PTMs for SLC1A5 Antibody (NBP1-89328)

Learn more about PTMs related to SLC1A5 Antibody (NBP1-89328).

Blogs on SLC1A5

There are no specific blogs for SLC1A5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC1A5 Antibody and receive a gift card or discount.


Gene Symbol SLC1A5