SLC16A9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC16A9 Antibody [NBP2-31030] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus.
Immunohistochemistry-Paraffin: SLC16A9 Antibody [NBP2-31030] - Staining of human adrenal gland shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry: SLC16A9 Antibody [NBP2-31030] - Staining of human rectum shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC16A9 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENINILDKSYSSEEKCRITLANGDWKQDSLLHK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC16A9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC16A9 Protein (NBP2-31030PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC16A9 Antibody

  • monocarboxylate transporter 9
  • C10orf36
  • MCT9
  • solute carrier family 16, member 9 (monocarboxylic acid transporter 9)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-69536
Species: Hu
Applications: WB
NBP1-91221
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59656
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82535
Species: Hu
Applications: IHC, IHC-P
NBP2-13315
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81251
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NB400-151
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB
NBP1-83936
Species: Hu
Applications: WB, IHC, IHC-P
AF3998
Species: Hu
Applications: WB
H00054898-P01
Species: Hu
MAB5175
Species: Mu
Applications: WB, IHC
NBP2-03626
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31030
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC16A9 Antibody (NBP2-31030) (0)

There are no publications for SLC16A9 Antibody (NBP2-31030).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC16A9 Antibody (NBP2-31030) (0)

There are no reviews for SLC16A9 Antibody (NBP2-31030). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC16A9 Antibody (NBP2-31030) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC16A9 Products

Bioinformatics Tool for SLC16A9 Antibody (NBP2-31030)

Discover related pathways, diseases and genes to SLC16A9 Antibody (NBP2-31030). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC16A9 Antibody (NBP2-31030)

Discover more about diseases related to SLC16A9 Antibody (NBP2-31030).
 

Pathways for SLC16A9 Antibody (NBP2-31030)

View related products by pathway.

Blogs on SLC16A9

There are no specific blogs for SLC16A9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC16A9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC16A9
Uniprot