LRRC16A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: LRRC16A Antibody [NBP1-91222] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human lymph node.
Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining in human testis and liver tissues using anti-CARMIL1 antibody. Corresponding CARMIL1 RNA-seq data are presented for ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human colon, kidney, lymph node and testis using Anti-CARMIL1 antibody NBP1-91222 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human kidney.
Immunohistochemistry-Paraffin: LRRC16A Antibody [NBP1-91222] - Staining of human colon.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRRC16A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKLADHFSRRGKTLPQQESLEIELAEEKPVKRSIITVEELTEIERLEDLDTCMMTPKSKRKSIHSRMLRPVSRAFEMEFDL
Specificity
Specificity of human LRRC16A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRRC16A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRRC16A Antibody

  • Arp2/3, and Myosin-I Linker homolog 1
  • CARMIL
  • CARMIL1
  • CARMIL1a
  • dJ501N12.1
  • dJ501N12.5
  • FLJ20048
  • FLJ43708
  • leucine rich repeat containing 16
  • leucine rich repeat containing 16A
  • leucine-rich repeat-containing protein 16A
  • LRRC16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12553
Species: Hu
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
AF1444
Species: Mu
Applications: WB, IHC
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89787
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-83385
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31030
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051177-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00116085-M02
Species: Hu
Applications: WB, ELISA
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80745
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-05054
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90625
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82501
Species: Hu
Applications: IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85614
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91222
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for LRRC16A Antibody (NBP1-91222) (0)

There are no publications for LRRC16A Antibody (NBP1-91222).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRRC16A Antibody (NBP1-91222) (0)

There are no reviews for LRRC16A Antibody (NBP1-91222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for LRRC16A Antibody (NBP1-91222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional LRRC16A Products

Bioinformatics Tool for LRRC16A Antibody (NBP1-91222)

Discover related pathways, diseases and genes to LRRC16A Antibody (NBP1-91222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRRC16A Antibody (NBP1-91222)

Discover more about diseases related to LRRC16A Antibody (NBP1-91222).
 

Pathways for LRRC16A Antibody (NBP1-91222)

View related products by pathway.

Blogs on LRRC16A

There are no specific blogs for LRRC16A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRRC16A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRRC16A