ELOVL2 Antibody - Azide and BSA Free

Western Blot: ELOVL2 Antibody [NBP3-04888] - Analysis of extracts of various cell lines, using ELOVL2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ELOVL2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ELOVL2 Antibody - Azide and BSA Free (NBP3-04888) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 247-296 of human ELOVL2 (NP_060240.3). ILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ELOVL2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for ELOVL2 Antibody - Azide and BSA Free

• EC 2.3.1.n8
• elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 2
• FLJ20334
• Ssc2
• SSC2elongation of very long chain fatty acids protein 2,3-keto acyl-CoA synthase ELOVL2

Background

Could be implicated in tissue-specific synthesis of very long chain fatty acids and sphingolipids. May catalyze one or both of the reduction reaction in fatty acid elongation, i.e., conversion of beta-ketoacyl CoA to beta-hydroxyacyl CoA or reduction of trans-2-enoyl CoA to the saturated acyl CoA derivative

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ELOVL2