SKAP55 Antibody

Images

 
Immunohistochemistry-Paraffin: SKAP55 Antibody [NBP1-87836] Staining of human lymph node shows moderate cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SKAP55 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SKAP55 Protein (NBP1-87836PEP)
Publications
Read Publication using NBP1-87836.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SKAP55 Antibody

  • SCAP1
  • SCAP1pp55
  • SKAP1
  • SKAP55
  • SKAP55SKAP-55
  • src family associated phosphoprotein 1
  • Src family-associated phosphoprotein 1
  • src kinase associated phosphoprotein 1
  • src kinase-associated phosphoprotein 1
  • Src kinase-associated phosphoprotein of 55 kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3857
Species: Hu
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-47289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
AF7279
Species: Hu, Mu
Applications: WB, ICC
NBP2-22526
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-248
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
796-IC
Species: Mu
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-89747
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB38461
Species: Hu
Applications: WB, IHC

Publications for SKAP55 Antibody (NBP1-87836)(1)

Reviews for SKAP55 Antibody (NBP1-87836) (0)

There are no reviews for SKAP55 Antibody (NBP1-87836). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SKAP55 Antibody (NBP1-87836) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SKAP55 Products

Bioinformatics Tool for SKAP55 Antibody (NBP1-87836)

Discover related pathways, diseases and genes to SKAP55 Antibody (NBP1-87836). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SKAP55 Antibody (NBP1-87836)

Discover more about diseases related to SKAP55 Antibody (NBP1-87836).
 

Pathways for SKAP55 Antibody (NBP1-87836)

View related products by pathway.

PTMs for SKAP55 Antibody (NBP1-87836)

Learn more about PTMs related to SKAP55 Antibody (NBP1-87836).

Blogs on SKAP55

There are no specific blogs for SKAP55, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SKAP55 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SKAP1
Entrez