SKAP55 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SKAP55 Antibody [NBP1-87836] - Staining of human cell line RPTEC TERT1 shows localization to nucleoplasm, plasma membrane & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SKAP55 Antibody [NBP1-87836] - Staining in human lymph node and skeletal muscle tissues using anti-SKAP1 antibody. Corresponding SKAP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SKAP55 Antibody [NBP1-87836] - Staining of human lymph node shows high expression.

Immunohistochemistry-Paraffin: SKAP55 Antibody [NBP1-87836] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SKAP55 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SKAP55 Antibody - BSA Free (NBP1-87836) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-SKAP55 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SKAP55 Protein (NBP1-87836PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SKAP55 Antibody - BSA Free

• SCAP1
• SCAP1pp55
• SKAP1
• SKAP55
• SKAP55SKAP-55
• src family associated phosphoprotein 1
• Src family-associated phosphoprotein 1
• src kinase associated phosphoprotein 1
• src kinase-associated phosphoprotein 1
• Src kinase-associated phosphoprotein of 55 kDa

Background

Src kinase-associated phosphoprotein of 55 kDa (SKAP55) is expressed as a constitutively tyrosine phosphorylated 55-kD adapter protein that positively regulates TCR signaling. SKAP55 has also been shown to enhance adhesion to fibronectin and ICAM1, colocalize with F-actin at the T cell-antigen-presenting cell synapse and promotes the clustering of LFA1 and TCR ligation. TCR engagement induces the translocation of SKAP55 to lipid rafts, where the interactions with Fyn take place. CD45 also plays a very important role in SKAP55/TCR-mediated signaling. SKAP55 involvement in the TCR signaling pathway is the subject of current research in murine as well as human models.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SKAP55 Antibody (NBP1-87836)(1)

Publication using NBP1-87836

• van Doorn R, van Kester MS, Dijkman R et al. Oncogenomic analysis of mycosis fungoides reveals major differences with Sezary syndrome. Blood 2009-01-01 [PMID: 18832135]

Bioinformatics

• Gene Symbol: SKAP1