SIX2 Antibody - BSA Free

Western Blot: SIX2 Antibody [NBP2-88276] - WB Suggested Anti-SIX2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Muscle

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

SIX2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human SIX2. Peptide sequence: WSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIX2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for SIX2 Antibody - BSA Free

• homeobox protein SIX2
• sine oculis homeobox (Drosophila) homolog 2
• sine oculis homeobox homolog 2 (Drosophila)
• Sine oculis homeobox homolog 2
• SIX homeobox 2

Background

The SIX2 gene is a member of the vertebrate gene family which encode proteins homologous to the Drosophila 'sine oculis' homeobox protein. The encoded protein is a transcription factor which, like other members of this gene family, may be involved in limb or

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SIX2