SIX4 Antibody (7E2) - Azide and BSA Free

Western Blot: SIX4 Antibody (7E2) [H00051804-M09] - Immunoblots indicate miR-124-induced SIX4 depletion. siSIX4 is shown as an antibody control. Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC4704493/) licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Analysis of monoclonal antibody to SIX4 on HeLa cell. Antibody concentration 15 ug/ml

Western Blot: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Analysis of SIX4 expression in Hela S3 NE (Cat # L013V3).

ELISA: SIX homeobox 4 Antibody (7E2) [H00051804-M09] - Detection limit for recombinant GST tagged SIX4 is approximately 0.1ng/ml as a capture antibody.

Western Blot: SIX4 Antibody (7E2) [H00051804-M09] - Immunoblots indicate consequence of SIX4 depletion on LKB1 accumulation and AMPK pathway activation. Image collected and cropped by CiteAb from the following publication (//www.ncbi.nlm.nih.gov/pmc/articles/PMC4704493/) licensed under a CC-BY license.

Western Blot: SIX4 Antibody (7E2) [H00051804-M09] - Selective addiction of EOC to the SIX4 homeobox transcription factorImmunoblots indicate miR‐124‐induced SIX4 depletion. siSIX4 is shown as an antibody control.Consequence of SIX4 depletion on EOC cell viability (as in Fig 2A, N, normal cell lines: HOSE, HBEC30).In vivo knockdown of SIX4 using neutral liposome‐incorporated siRNA reduced tumor burden & ascites volume in an orthotopic xenograft mouse model. Box‐and‐whisker plot of tumor weight (left panel) or ascites volume (right panel) from n = 7 or 8 mice per condition as indicated. *P‐value from Student's t‐test.Consequence of SIX4 depletion in PEO1 cells on E‐cadherin plasma membrane accumulation 48 h after transfection. Cells were counterstained with phalloidin & DAPI.Immunoblots indicate consequence of SIX4 depletion on LKB1 accumulation & AMPK pathway activation.Source data are available online for this figure. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26655797), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: SIX4 Antibody (7E2) [H00051804-M09] - Selective addiction of EOC to the SIX4 homeobox transcription factorImmunoblots indicate miR‐124‐induced SIX4 depletion. siSIX4 is shown as an antibody control.Consequence of SIX4 depletion on EOC cell viability (as in Fig 2A, N, normal cell lines: HOSE, HBEC30).In vivo knockdown of SIX4 using neutral liposome‐incorporated siRNA reduced tumor burden & ascites volume in an orthotopic xenograft mouse model. Box‐and‐whisker plot of tumor weight (left panel) or ascites volume (right panel) from n = 7 or 8 mice per condition as indicated. *P‐value from Student's t‐test.Consequence of SIX4 depletion in PEO1 cells on E‐cadherin plasma membrane accumulation 48 h after transfection. Cells were counterstained with phalloidin & DAPI.Immunoblots indicate consequence of SIX4 depletion on LKB1 accumulation & AMPK pathway activation.Source data are available online for this figure. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/26655797), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, Mycoplasma
• Clone: 7E2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SIX4 Antibody (7E2) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse SIX4 Antibody (7E2) - Azide and BSA Free (H00051804-M09) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. Anti-SIX4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: SIX4 (NP_059116, 672 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD
• Specificity: SIX4 (7E2)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SIX4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SIX4 Antibody (7E2) - Azide and BSA Free

• AREC3
• homeobox protein SIX4
• MGC119450
• MGC119452
• MGC119453
• sine oculis homeobox (Drosophila) homolog 4
• sine oculis homeobox homolog 4 (Drosophila)
• Sine oculis homeobox homolog 4
• SIX homeobox 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SIX4 Antibody (H00051804-M09)(1)

Publication using H00051804-M09

• Shields BB, Pecot CV, Gao H et al. A genome-scale screen reveals context-dependent ovarian cancer sensitivity to miRNA overexpression. Mol. Syst. Biol. 2015-12-15 [PMID: 26655797] (WB, Human)

Bioinformatics

• Gene Symbol: SIX4
• Entrez:
  • 51804(Human)
• OMIM:
  • 606342(Human)
• Uniprot:
  • NP_059116(Human)