Home » CITED1 » CITED1 Antibodies » CITED1 Antibody (5H6)

CITED1 Antibody (5H6)

 (3 Publications)
 (2 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03), clone 5H6. Lane 1: CITED1 transfected lysatE (19.9 KDa). Lane 2: Non-transfected lysate.
Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03), clone 5H6. Lane 1: CITED1 transfected lysatE (19.9 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - analysis of CITED1 expression in human embryonic kidney cells using anti-CITED1 antibody. Image from verified customer review.
Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - Representative image of CITED1 immunostaining. Arrowheads indicate the presence of immunostaining signal. Scale bar = 100 um. Image collected and cropped by ...read more
Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in A-431 (Cat # L015V1).
Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of monoclonal antibody to CITED1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.2 ug/ml
Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 on paraffin embedded human fetal renal tissue. Image from verified customer review.
Immunohistochemistry: CITED1 Antibody (5H6) [H00004435-M03] - Representative image of CITED1 immunostaining in a w15 human fetal kidney. Dashed lines in the insets indicate the outline of the nuclei, based on DAPI ...read more
ELISA: CITED1 Antibody (5H6) [H00004435-M03] - Detection limit for recombinant GST tagged CITED1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Clone
5H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

CITED1 Antibody (5H6) Summary

Immunogen
CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CITED1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Flow Cytometry 1:10-1:1000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
Application Notes
FACS usage reported in scientific literature (PMID: 24349133).
Reviewed Applications
Read 2 Reviews rated 4
using
H00004435-M03 in the following applications:
Publications
Read Publications using
H00004435-M03 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CITED1 Antibody (5H6)

  • cbp/p300-interacting transactivator 1
  • Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1
  • melanocyte-specific gene 1

Background

CITED1 is highly expressed in most of the papillary thyroid carcinoma. It is not expressed in normal tissues except normal breast epithelium. Study shows that this protein functions as a selective coactivator for estrogen dependent transcription.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cited-2 Antibody
(JA22) - BSA Free
NB100-136
Immunohistochemistry-Paraffin: Cited-2 Antibody (JA22) [NB100-136] - IHC analysis of a formain fixed paraffin embedded (FFPE) tissue section of human breast cancer using Cited-2 antibody at 1:500 dilution. The primary antibody bound to CAIX antigens in the tissue section was detected using a HRP labeled secondary antibody and DAB reagent. Nuclei of the cells were counterstained with hematoxylin. Staining was localized to the nucleus.
Western Blot: Cited-2 Antibody (JA22) [NB100-136] - Total protein from human HeLa and MCF7 and mouse 3T3 cell lines was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-Cited in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using West Pico PLUS chemiluminescence detection reagent.
Immunocytochemistry/Immunofluorescence: Cited-2 Antibody (JA22) [NB100-136] - The Cited-2 (JA22) antibody was tested at a 1:250 dilution in HeLa cells against Dylight 488 (Green). Beta-tubulin and nuclei were counterstained against Dylight 550 (Red) and DAPI (Blue).
(12 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Cytokeratin 19
Antibody - BSA Free
NB100-687
Flow Cytometry: Cytokeratin 19 Antibody [NB100-687] - An intracellular stain was performed on MCF7 cells with Cytokeratin 19 Antibody NB100-687AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: Cytokeratin 19 Antibody [NB100-687] - Western blot detection of YAP and TAZ in proteins extracted from isolated hepatocytes and cholangiocytes and total liver tissue. Antibodies against CK19 and HNF4a were used to confirm purity of the populations and b-actin was used as a loading control. Representative results from a single experiment with n = 3 independent cell isolations and n = 2 total liver tissues. Image collected and cropped by CiteAb from the following publication(http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201506089), licensed under a CC-BY licence.
Immunohistochemistry: Cytokeratin 19 Antibody [NB100-687] - Inhibition of MST improves liver regeneration in aged mice. Representative photomicrograph of an aged liver treated with siMST and stained with H&E and by IHC for CK19 and Ki67. Arrows indicate ductal regions with no signs of reaction or oval cell expansion. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201506089), licensed under a CC-BY licence.
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
CBP/KAT3A Antibody
NB100-381
Western Blot: CBP/KAT3A Antibody [NB100-381] - Detection of Human CBP by Western Blot. Samples: Whole cell lysate (5, 15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody NB100-381 used for WB at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 3 minutes.
Immunoprecipitation: CBP/KAT3A Antibody [NB100-381] - Whole cell lysate (1 mg for IP; 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-CBP antibody used for IP at 6 ug/mg lysate. CBP was also immunoprecipitated by rabbit anti-CBP antibody NB100-382. For blotting immunoprecipitated CBP, was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ChIP, IP, WB
PAG1 Antibody
(504004) [Unconjugate
MAB5285
Simple Western lane view shows lysates of Raji human Burkitt's lymphoma cell line and Daudi human Burkitt's lymphoma cell line, loaded at 0.2 mg/mL. A specific band was detected for PAG1 at approximately 76 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human PAG1 Monoclonal Antibody (Catalog # MAB5285). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of Daudi human Burkitt's lymphoma cell line and Raji human Burkitt's lymphoma cell line. PVDF Membrane was probed with 1 µg/mL of Human PAG1 Polyclonal Antibody (Catalog # MAB5285) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for PAG1 at approximately 70-85 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: Simple Western, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot: Opsin 1 (Long Wave) Antibody [NBP3-09392] - Western blot analysis of Opsin 1 (Long Wave) in Fetal Heart lysates. Antibody dilution at 1.0ug/ml
Species: Hu, Mu
Applications: WB
MCG10 Antibody
NBP1-76729
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - Hela cells.
Western Blot: MCG10 Antibody [NBP1-76729] - HeLa cell lysate with MCG10 antibody at (A) 0.5, (B) 1 and (C) 2 u/mL.
Immunocytochemistry/Immunofluorescence: MCG10 Antibody [NBP1-76729] - HeLa cells with MCG10 antibody at 1 ug/ml.
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, WB
eIF4E [p Ser209]
Antibody
NB100-81898
Western Blot: eIF4E [p Ser209] Antibody [NB100-81898] - Analysis of extracts from SK-BR-3 cells, untreated or insulin and EGF treated, and pretreated with U0126 cells, using eIF4E (Phospho-Ser209) Antibody.
Immunocytochemistry/Immunofluorescence: eIF4E [p Ser209] Antibody [NB100-81898] - Staining of methanol-fixed MCF cells using eIF4E(Phospho-Ser209) antibody
Immunohistochemistry: eIF4E [p Ser209] Antibody [NB100-81898] - Immunohistochemical analysis of paraffin-embedded human breast carcinoma tissue, using elF4E (phospho-Ser209) antibody
(1 Publication)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Flow Cytometry: KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on Raw264.7 cells with KAT3B/p300 Antibody (RW105) NB100-616 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B/p300 Antibody (RW105) NB100-616 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(9 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
Smad4 Antibody
NBP2-24951
Immunohistochemistry-Paraffin: Smad4 Antibody [NBP2-24951] - Analysis of a FFPE tissue section of human colon using 1:200 dilution of SMAD4 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Apical cytoplasmic staining was observed in both glandular and epithelial cells.
Immunocytochemistry/Immunofluorescence: Smad4 Antibody [NBP2-24951] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-SMAD4 Antibody NBP2-24951 at 2 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Western Blot: Smad4 Antibody [NBP2-24951] - SMAD4 Antibody [NBP2-24951] - Analysis using SMAD4 antibody. Lysate from A549 cells probed with SMAD4 antibody at 2 ug/mL.
(3 Reviews)
(2 Publications)
Species: Bv, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Galectin-3 [HRP]
DGAL30
(31 Publications)
Species: Hu
Applications: ELISA
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in MCF-7 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human liver tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(40 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
MPP1 Antibody
(1E11-1G11)
H00004354-M01
Western Blot: MPP1 Antibody (1E11-1G11) [H00004354-M01] - Analysis of MPP1 expression in transfected 293T cell line by MPP1 monoclonal antibody (M01), clone 1E11-1G11.Lane 1: MPP1 transfected lysate (Predicted MW: 52.3 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: MPP1 Antibody (1E11-1G11) [H00004354-M01] - Analysis of monoclonal antibody to MPP1 on HeLa cell . Antibody concentration 10 ug/ml.
Immunoprecipitation: MPP1 Antibody (1E11-1G11) [H00004354-M01] - Analysis of MPP1 transfected lysate using anti-MPP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MPP1 monoclonal antibody.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
MEIS2 Antibody
(1H4)
H00004212-M01
Western Blot: MEIS2 Antibody (1H4) [H00004212-M01] - Analysis of MEIS2 expression in transfected 293T cell line by MEIS2 monoclonal antibody (M01), clone 1H4.Lane 1: MEIS2 transfected lysate(51.1 KDa).Lane 2: Non-transfected lysate.
ELISA: MEIS2 Antibody (1H4) [H00004212-M01] - Detection limit for recombinant GST tagged MEIS2 is approximately 0.03ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: MEIS2 Antibody (1H4) [H00004212-M01] - Analysis of monoclonal antibody to MEIS2 on HeLa cell. Antibody concentration 10 ug/ml.
(5 Publications)
Species: Hu, Pm, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
B-Raf Antibody
(OTI5A9)
NBP1-47668
Immunohistochemistry: B-Raf Antibody (OTI5A9) [NBP1-47668] - The images depict immunostaining of representative PTC cases harboring BRAF wild-type (A, B) and BRAF V600E mutation (C, D) proven by NGS; varying degrees of immunoreactivity for BRAF is shown both in the intranuclear inclusions (arrows) and in the cytoplasm. Original magnifications: 1,000 X.
Western Blot: B-Raf Antibody (OTI5A9) [NBP1-47668] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY BRAF (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with antibody
Flow Cytometry: B-Raf Antibody (OTI5A9) [NBP1-47668] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-B Raf antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
SIX2 Antibody (3D7)
H00010736-M01
Western Blot: SIX2 Antibody (3D7) [H00010736-M01] - Analysis of SIX2 expression in transfected 293T cell line by SIX2 monoclonal antibody (M01), clone 3D7.Lane 1: SIX2 transfected lysate(32.3 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: SIX2 Antibody (3D7) [H00010736-M01] - Characterization of immunosorted NCAM1+ subpopulation. Double labelling of sorted NCAM1+ cells for NCAM1 and SIX2: NCAM1 with DAPI (upper panel; red and blue channels), NCAM1 with SIX2 (lower panel; red and green channels), indicating both NCAM1+ SIX2+ (arrows) and NCAM1+ SIX2- (arrowheads) cells. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201201584), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: SIX2 Antibody (3D7) [H00010736-M01] - NCAM1 expression in mouse embryonic kidney organ and hFK serum-free cultures. Mouse embryonic kidney organ culture stained for Ncam1, Six2 and E-cad as indicated. An enlargement of the Ncam/Six2 signal is shown to emphasize the nuclear localization of Six2. White arrow illustrates the absence of Six2 signal in E-cad positive cells. An occurrence of Six2/E-cad positive cells is indicated with the asterisk. Images were obtained using Nikon A1R confocal microscope with and processed in ImageJ/Fiji software. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201201584), licensed under a CC-BY licence.
(8 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, KD, WB
Factor IX Antibody
NBP1-33581
Immunohistochemistry-Paraffin: Factor IX Antibody [NBP1-33581] - Mouse pancreas. Factor IX antibody [N3C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: Factor IX Antibody [NBP1-33581] - Mouse liver. Factor IX stained by Factor IX antibody [N3C3] diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunocytochemistry/Immunofluorescence: Factor IX Antibody [NBP1-33581] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Factor IX protein stained by Factor IX antibody [N3C3] diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Ret Antibody
[Unconjugated]
AF482
Ret was detected in perfusion fixed frozen sections of mouse spinal cord using Goat Anti-Mouse Ret Antigen Affinity-purified Polyclonal Antibody (Catalog # AF482) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to the ventral horn. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(29 Publications)
Species: Mu
Applications: IHC, WB

Publications for CITED1 Antibody (H00004435-M03)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 4 applications: FLOW, ICC/IF, IHC-P, WB.


Filter By Application
FLOW
(1)
ICC/IF
(1)
IHC-P
(2)
WB
(1)
All Applications
Filter By Species
Human
(3)
All Species

Reviews for CITED1 Antibody (H00004435-M03) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using H00004435-M03:
Filter by Applications
IHC-P
(1)
IF
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin CITED1 H00004435-M03
Enlarge 		4
reviewed by:
Stefano Da Sacco
 IHC-P Human 10/31/2016
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedfetal renal tissue
SpeciesHuman

Comments

CommentsLow pH antigen retrieval of paraffin embedded tissue
Immunofluorescence CITED1 H00004435-M03
Enlarge 		4
reviewed by:
Verified Customer
 IF Human 10/23/2014
View

Summary

ApplicationImmunofluorescence
Sample Testedhuman fetal kidney cells
SpeciesHuman
Lot11088-5h6

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CITED1 Antibody (H00004435-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CITED1 Products

Bioinformatics Tool for CITED1 Antibody (H00004435-M03)

Discover related pathways, diseases and genes to CITED1 Antibody (H00004435-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CITED1 Antibody (H00004435-M03)

Discover more about diseases related to CITED1 Antibody (H00004435-M03).
 

Pathways for CITED1 Antibody (H00004435-M03)

View related products by pathway.

PTMs for CITED1 Antibody (H00004435-M03)

Learn more about PTMs related to CITED1 Antibody (H00004435-M03).

Blogs on CITED1

There are no specific blogs for CITED1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0
Immunohistochemistry-Paraffin CITED1 H00004435-M03
Enlarge
 Stefano Da Sacco
10/31/2016
Application: IHC-P
Species: Human
read this review
Immunofluorescence CITED1 H00004435-M03
Enlarge
 Verified Customer
10/23/2014
Application: IF
Species: Human
read this review

Bioinformatics

Gene Symbol CITED1
Entrez
OMIM
Uniprot