CITED1 Antibody (5H6)

Images

 
Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in transfected 293T cell line by CITED1 monoclonal antibody (M03), clone 5H6. Lane 1: CITED1 transfected lysatE (19.9 KDa). Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: CITED1 Antibody (5H6) [H00004435-M03] - analysis of CITED1 expression in human embryonic kidney cells using anti-CITED1 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 on paraffin embedded human fetal renal tissue. Image from verified customer review.
Western Blot: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of CITED1 expression in A-431 (Cat # L015V1).
Immunohistochemistry-Paraffin: CITED1 Antibody (5H6) [H00004435-M03] - Analysis of monoclonal antibody to CITED1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1.2 ug/ml
ELISA: CITED1 Antibody (5H6) [H00004435-M03] - Detection limit for recombinant GST tagged CITED1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Clone
5H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CITED1 Antibody (5H6) Summary

Immunogen
CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CITED1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Flow Cytometry 1:10-1:1000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
FACS usage reported in scientific literature (PMID: 24349133).
Reviewed Applications
Read 2 Reviews rated 4
using
H00004435-M03 in the following applications:

Publications
Read Publications using
H00004435-M03 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CITED1 Antibody (5H6)

  • cbp/p300-interacting transactivator 1
  • Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain1,MSG1Melanocyte-specific protein 1
  • melanocyte-specific gene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
MAB5285
Species: Hu
Applications: WB, Simple Western
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP2-24951
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF1197
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00004354-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
H00004212-M01
Species: Hu, Mu, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47668
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00010736-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, KD
AF482
Species: Mu
Applications: WB, IHC

Publications for CITED1 Antibody (H00004435-M03)(3)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 4 applications: FLOW, ICC/IF, IHC-P, WB.


Filter By Application
FLOW
(1)
ICC/IF
(1)
IHC-P
(2)
WB
(1)
All Applications
Filter By Species
Human
(3)
All Species

Reviews for CITED1 Antibody (H00004435-M03) (2) 42

Average Rating: 4
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using H00004435-M03:
Filter by Applications
IHC-P
(1)
IF
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin CITED1 H00004435-M03
Enlarge
4
reviewed by:
Verified Customer
IHC-P Human 10/31/2016
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedfetal renal tissue
SpeciesHuman

Comments

CommentsLow pH antigen retrieval of paraffin embedded tissue
Immunofluorescence CITED1 H00004435-M03
Enlarge
4
reviewed by:
Stefano Da Sacco
IF Human 10/23/2014
View

Summary

ApplicationImmunofluorescence
Sample Testedhuman fetal kidney cells
SpeciesHuman
Lot11088-5h6

Blocking

Blocking DetailsBSA 5%, 30 minutes

Primary Anitbody

Dilution Ratio1: 200

Details

Fixation DetailsPFA 4%, 10 minutes
Wash DescriptionPBS

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CITED1 Antibody (H00004435-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CITED1 Products

Bioinformatics Tool for CITED1 Antibody (H00004435-M03)

Discover related pathways, diseases and genes to CITED1 Antibody (H00004435-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CITED1 Antibody (H00004435-M03)

Discover more about diseases related to CITED1 Antibody (H00004435-M03).
 

Pathways for CITED1 Antibody (H00004435-M03)

View related products by pathway.

PTMs for CITED1 Antibody (H00004435-M03)

Learn more about PTMs related to CITED1 Antibody (H00004435-M03).

Blogs on CITED1

There are no specific blogs for CITED1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
2
3
0
2
0
1
0

Verified Customer
10/31/2016
Application: IHC-P
Species: Human

Stefano Da Sacco
10/23/2014
Application: IF
Species: Human

Bioinformatics

Gene Symbol CITED1
Entrez
OMIM
Uniprot